BLASTX nr result
ID: Ophiopogon25_contig00015088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00015088 (660 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW82590.1| hypothetical protein EUGRSUZ_C03983 [Eucalyptus g... 55 5e-06 ref|XP_010669495.1| PREDICTED: AIG2-like protein D [Beta vulgari... 55 6e-06 ref|XP_009417515.1| PREDICTED: AIG2-like protein [Musa acuminata... 55 7e-06 gb|KCW82588.1| hypothetical protein EUGRSUZ_C03983 [Eucalyptus g... 54 7e-06 gb|AFK47391.1| unknown [Lotus japonicus] 54 9e-06 ref|XP_009415527.1| PREDICTED: protein AIG2-like [Musa acuminata... 54 1e-05 >gb|KCW82590.1| hypothetical protein EUGRSUZ_C03983 [Eucalyptus grandis] Length = 130 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 179 TLQDNSEKLLANAYVWADKDDPDLYGDWDLEV 84 TL D+S+KL A AYVW+DK DP+LYGDWD EV Sbjct: 90 TLLDSSDKLEAEAYVWSDKHDPNLYGDWDFEV 121 >ref|XP_010669495.1| PREDICTED: AIG2-like protein D [Beta vulgaris subsp. vulgaris] gb|KMT17776.1| hypothetical protein BVRB_2g035220 [Beta vulgaris subsp. vulgaris] Length = 179 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 179 TLQDNSEKLLANAYVWADKDDPDLYGDWDLE 87 TL DN EKL A AYVW DK+DPDLYGDWD E Sbjct: 102 TLADNLEKLQAYAYVWDDKNDPDLYGDWDFE 132 >ref|XP_009417515.1| PREDICTED: AIG2-like protein [Musa acuminata subsp. malaccensis] Length = 169 Score = 55.1 bits (131), Expect = 7e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -2 Query: 179 TLQDNSEKLLANAYVWADKDDPDLYGDWDLEVEFQEKDDKD 57 +L D SEKLLANAYVW+DK+DP+LY +WD E E++ KD Sbjct: 96 SLLDKSEKLLANAYVWSDKNDPNLYSEWDFE-EWKRLHKKD 135 >gb|KCW82588.1| hypothetical protein EUGRSUZ_C03983 [Eucalyptus grandis] Length = 135 Score = 54.3 bits (129), Expect = 7e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -2 Query: 179 TLQDNSEKLLANAYVWADKDDPDLYGDWDLEVEFQE 72 TL D+S+KL A AYVW+DK DP+LYGDWD E Q+ Sbjct: 90 TLLDSSDKLEAEAYVWSDKHDPNLYGDWDFEAGCQD 125 >gb|AFK47391.1| unknown [Lotus japonicus] Length = 149 Score = 54.3 bits (129), Expect = 9e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -2 Query: 176 LQDNSEKLLANAYVWADKDDPDLYGDWDLEVE 81 L DNSEK+ AYVW++KDDPDLYG+W+ E+E Sbjct: 106 LMDNSEKMQVYAYVWSNKDDPDLYGEWEFEME 137 >ref|XP_009415527.1| PREDICTED: protein AIG2-like [Musa acuminata subsp. malaccensis] Length = 151 Score = 54.3 bits (129), Expect = 1e-05 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -2 Query: 179 TLQDNSEKLLANAYVWADKDDPDLYGDWDLE 87 +L DNSEKL+ +AYVW +KDDP+LYG+WD E Sbjct: 95 SLVDNSEKLIVDAYVWGNKDDPNLYGEWDFE 125