BLASTX nr result
ID: Ophiopogon25_contig00014485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00014485 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256398.1| BTB/POZ domain-containing protein At3g50780 ... 97 6e-21 ref|XP_010941741.1| PREDICTED: BTB/POZ domain-containing protein... 96 2e-20 ref|XP_010941924.1| PREDICTED: BTB/POZ domain-containing protein... 94 5e-20 ref|XP_020583472.1| BTB/POZ domain-containing protein At3g50780 ... 94 1e-19 ref|XP_020694379.1| BTB/POZ domain-containing protein At3g50780 ... 93 1e-19 ref|XP_008808898.1| PREDICTED: BTB/POZ domain-containing protein... 93 2e-19 gb|POO02626.1| Voltage dependent potassium channel [Trema orient... 91 7e-19 ref|XP_008797004.1| PREDICTED: BTB/POZ domain-containing protein... 91 1e-18 ref|XP_020096175.1| BTB/POZ domain-containing protein At3g50780 ... 91 1e-18 gb|PON54098.1| SKP1/BTB/POZ domain containing protein [Parasponi... 91 1e-18 ref|XP_010097900.1| BTB/POZ domain-containing protein At3g50780 ... 91 1e-18 ref|XP_012079112.1| BTB/POZ domain-containing protein At3g50780 ... 91 1e-18 gb|ESR39009.1| hypothetical protein CICLE_v10026330mg [Citrus cl... 87 2e-18 ref|XP_006425769.2| BTB/POZ domain-containing protein At3g50780,... 87 6e-18 ref|XP_021303469.1| BTB/POZ domain-containing protein At3g50780 ... 89 6e-18 ref|XP_004981621.1| BTB/POZ domain-containing protein At3g50780 ... 89 6e-18 gb|KDO79429.1| hypothetical protein CISIN_1g014635mg [Citrus sin... 87 7e-18 ref|XP_018680594.1| PREDICTED: BTB/POZ domain-containing protein... 88 8e-18 ref|XP_009388509.1| PREDICTED: BTB/POZ domain-containing protein... 88 8e-18 ref|XP_008665486.1| BTB/POZ domain-containing protein At3g50780 ... 88 8e-18 >ref|XP_020256398.1| BTB/POZ domain-containing protein At3g50780 [Asparagus officinalis] ref|XP_020256399.1| BTB/POZ domain-containing protein At3g50780 [Asparagus officinalis] gb|ONK74591.1| uncharacterized protein A4U43_C03F8070 [Asparagus officinalis] Length = 513 Score = 97.1 bits (240), Expect = 6e-21 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDRN 234 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRP+VEQQAN LQ D+N Sbjct: 467 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPHVEQQANMLQGDKN 513 >ref|XP_010941741.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Elaeis guineensis] ref|XP_010941747.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Elaeis guineensis] ref|XP_010941755.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Elaeis guineensis] Length = 526 Score = 95.9 bits (237), Expect = 2e-20 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDRN 234 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQ N +Q+DR+ Sbjct: 480 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQGNLVQSDRS 526 >ref|XP_010941924.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis guineensis] ref|XP_010941925.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis guineensis] ref|XP_019711244.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis guineensis] Length = 526 Score = 94.4 bits (233), Expect = 5e-20 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDRN 234 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQ N Q DR+ Sbjct: 480 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQGNLAQLDRS 526 >ref|XP_020583472.1| BTB/POZ domain-containing protein At3g50780 [Phalaenopsis equestris] ref|XP_020583473.1| BTB/POZ domain-containing protein At3g50780 [Phalaenopsis equestris] ref|XP_020583474.1| BTB/POZ domain-containing protein At3g50780 [Phalaenopsis equestris] Length = 526 Score = 93.6 bits (231), Expect = 1e-19 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDR 237 +LSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPY+EQ+ N LQ+DR Sbjct: 478 MLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYLEQRGNTLQSDR 523 >ref|XP_020694379.1| BTB/POZ domain-containing protein At3g50780 [Dendrobium catenatum] ref|XP_020694381.1| BTB/POZ domain-containing protein At3g50780 [Dendrobium catenatum] gb|PKU64770.1| BTB/POZ domain-containing protein [Dendrobium catenatum] Length = 528 Score = 93.2 bits (230), Expect = 1e-19 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTD 240 +LSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPY+EQQ N LQ+D Sbjct: 480 MLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYLEQQGNALQSD 524 >ref|XP_008808898.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix dactylifera] ref|XP_008808899.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix dactylifera] ref|XP_008808900.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix dactylifera] Length = 528 Score = 92.8 bits (229), Expect = 2e-19 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTD 240 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQ N Q+D Sbjct: 480 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQGNLAQSD 524 >gb|POO02626.1| Voltage dependent potassium channel [Trema orientalis] Length = 531 Score = 91.3 bits (225), Expect = 7e-19 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDR 237 LLSWLGSFLK GDNCPNLQRAFEVWWRRTF+RPYVE Q N LQ+D+ Sbjct: 486 LLSWLGSFLKAGDNCPNLQRAFEVWWRRTFVRPYVEPQDNSLQSDK 531 >ref|XP_008797004.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix dactylifera] Length = 526 Score = 90.5 bits (223), Expect = 1e-18 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDRN 234 LLSW GSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQ N Q+ R+ Sbjct: 480 LLSWFGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQGNLAQSARS 526 >ref|XP_020096175.1| BTB/POZ domain-containing protein At3g50780 [Ananas comosus] ref|XP_020096176.1| BTB/POZ domain-containing protein At3g50780 [Ananas comosus] Length = 528 Score = 90.5 bits (223), Expect = 1e-18 Identities = 42/48 (87%), Positives = 43/48 (89%), Gaps = 1/48 (2%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQ-ANQLQTDRN 234 LLSWLGSFLK+GDNCPNLQRAFEVWWRRTFIRPYVEQQ N L DRN Sbjct: 481 LLSWLGSFLKIGDNCPNLQRAFEVWWRRTFIRPYVEQQHGNILPLDRN 528 >gb|PON54098.1| SKP1/BTB/POZ domain containing protein [Parasponia andersonii] Length = 531 Score = 90.5 bits (223), Expect = 1e-18 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTD 240 LLSWLGSFLK GDNCPNLQRAFEVWWRRTF+RPYVE Q N LQ+D Sbjct: 486 LLSWLGSFLKAGDNCPNLQRAFEVWWRRTFVRPYVEPQDNSLQSD 530 >ref|XP_010097900.1| BTB/POZ domain-containing protein At3g50780 [Morus notabilis] gb|EXB72727.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 532 Score = 90.5 bits (223), Expect = 1e-18 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDR 237 LLSWLGSFLK GDNCPNLQRAFEVWWRRTF+RPYVE Q N Q+D+ Sbjct: 487 LLSWLGSFLKAGDNCPNLQRAFEVWWRRTFVRPYVEPQGNSFQSDK 532 >ref|XP_012079112.1| BTB/POZ domain-containing protein At3g50780 [Jatropha curcas] gb|KDP31825.1| hypothetical protein JCGZ_12286 [Jatropha curcas] Length = 534 Score = 90.5 bits (223), Expect = 1e-18 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTD 240 LLSWLGSFLK GDNCPNLQRAFEVWWRRTFIRPY+E Q N LQ+D Sbjct: 483 LLSWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYIETQGNLLQSD 527 >gb|ESR39009.1| hypothetical protein CICLE_v10026330mg [Citrus clementina] Length = 254 Score = 87.4 bits (215), Expect = 2e-18 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTD 240 LL+WLGSFLK GDNCPNLQRAFEVWWRRTFIRPYV+ Q N +Q+D Sbjct: 203 LLAWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYVDAQGNLVQSD 247 >ref|XP_006425769.2| BTB/POZ domain-containing protein At3g50780, partial [Citrus clementina] Length = 327 Score = 87.4 bits (215), Expect = 6e-18 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTD 240 LL+WLGSFLK GDNCPNLQRAFEVWWRRTFIRPYV+ Q N +Q+D Sbjct: 276 LLAWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYVDAQGNLVQSD 320 >ref|XP_021303469.1| BTB/POZ domain-containing protein At3g50780 [Sorghum bicolor] ref|XP_021303474.1| BTB/POZ domain-containing protein At3g50780 [Sorghum bicolor] ref|XP_021303477.1| BTB/POZ domain-containing protein At3g50780 [Sorghum bicolor] gb|KXG37471.1| hypothetical protein SORBI_3001G076400 [Sorghum bicolor] gb|KXG37472.1| hypothetical protein SORBI_3001G076400 [Sorghum bicolor] gb|KXG37473.1| hypothetical protein SORBI_3001G076400 [Sorghum bicolor] Length = 526 Score = 88.6 bits (218), Expect = 6e-18 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDRN 234 LLSWLGSFLKVGD+CPNLQ+AFEVWWRRTFIRPY EQQ N+ Q+ R+ Sbjct: 480 LLSWLGSFLKVGDSCPNLQKAFEVWWRRTFIRPYAEQQGNRSQSGRS 526 >ref|XP_004981621.1| BTB/POZ domain-containing protein At3g50780 [Setaria italica] ref|XP_012698487.1| BTB/POZ domain-containing protein At3g50780 [Setaria italica] ref|XP_022685556.1| BTB/POZ domain-containing protein At3g50780 [Setaria italica] ref|XP_022685557.1| BTB/POZ domain-containing protein At3g50780 [Setaria italica] ref|XP_022685558.1| BTB/POZ domain-containing protein At3g50780 [Setaria italica] gb|KQK86916.1| hypothetical protein SETIT_035150mg [Setaria italica] Length = 526 Score = 88.6 bits (218), Expect = 6e-18 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDRN 234 LLSWLGSFLKVGD+CPNLQ+AFEVWWRRTFIRPY EQQ N+ Q+ R+ Sbjct: 480 LLSWLGSFLKVGDSCPNLQKAFEVWWRRTFIRPYAEQQGNRSQSGRS 526 >gb|KDO79429.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis] Length = 357 Score = 87.4 bits (215), Expect = 7e-18 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTD 240 LL+WLGSFLK GDNCPNLQRAFEVWWRRTFIRPYV+ Q N +Q+D Sbjct: 306 LLAWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYVDAQGNLVQSD 350 >ref|XP_018680594.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_018680595.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_018680596.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_018680597.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_018680598.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_018680599.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_018680600.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_018680601.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_018680602.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_018680603.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] Length = 522 Score = 88.2 bits (217), Expect = 8e-18 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDRN 234 LLSWL SFLKVG NCPNLQRAFEVWWRRTFIRPY EQ N L+ DRN Sbjct: 476 LLSWLESFLKVGSNCPNLQRAFEVWWRRTFIRPYFEQHGNNLKMDRN 522 >ref|XP_009388509.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_009388510.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_009388511.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_009388512.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_009388513.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] ref|XP_018678070.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa acuminata subsp. malaccensis] Length = 532 Score = 88.2 bits (217), Expect = 8e-18 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDRN 234 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVE Q Q+D++ Sbjct: 486 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEYQGINPQSDKS 532 >ref|XP_008665486.1| BTB/POZ domain-containing protein At3g50780 [Zea mays] ref|XP_008665487.1| BTB/POZ domain-containing protein At3g50780 [Zea mays] gb|ONM09781.1| BTB/POZ domain-containing protein [Zea mays] gb|ONM09782.1| BTB/POZ domain-containing protein [Zea mays] gb|ONM09783.1| BTB/POZ domain-containing protein [Zea mays] gb|ONM09784.1| BTB/POZ domain-containing protein [Zea mays] Length = 534 Score = 88.2 bits (217), Expect = 8e-18 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -3 Query: 374 LLSWLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQANQLQTDRN 234 LLSWLGSFLKVGD+CPNLQ+AFEVWWRRTF+RPY EQQ N+ Q+ R+ Sbjct: 488 LLSWLGSFLKVGDSCPNLQKAFEVWWRRTFVRPYAEQQGNRSQSGRS 534