BLASTX nr result
ID: Ophiopogon25_contig00014414
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00014414 (600 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251273.1| peptidyl-prolyl cis-trans isomerase CYP95-li... 128 1e-30 ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 117 9e-27 ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 115 3e-26 ref|XP_010914921.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 112 4e-25 ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 112 4e-25 ref|XP_021275810.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 110 1e-24 ref|XP_021275807.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 110 1e-24 ref|XP_021275806.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 110 1e-24 ref|XP_021275805.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 110 1e-24 ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 110 2e-24 ref|XP_020087995.1| peptidyl-prolyl cis-trans isomerase CYP95 [A... 110 2e-24 ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 108 8e-24 gb|EOY31440.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isofo... 107 1e-23 gb|EOY31437.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isofo... 107 1e-23 ref|XP_017983288.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 107 1e-23 gb|OVA00494.1| Cyclophilin-like peptidyl-prolyl cis-trans isomer... 107 2e-23 gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isofo... 107 2e-23 ref|XP_007013817.2| PREDICTED: peptidyl-prolyl cis-trans isomera... 107 2e-23 gb|EOY31439.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isofo... 107 2e-23 ref|XP_007013820.2| PREDICTED: peptidyl-prolyl cis-trans isomera... 107 2e-23 >ref|XP_020251273.1| peptidyl-prolyl cis-trans isomerase CYP95-like [Asparagus officinalis] gb|ONK81011.1| uncharacterized protein A4U43_C01F24280 [Asparagus officinalis] Length = 823 Score = 128 bits (321), Expect = 1e-30 Identities = 80/199 (40%), Positives = 90/199 (45%) Frame = +2 Query: 2 KDKGGSMSRSSARSLPRKXXXXXXXXXXXXXXXXXXXXXDARKSLXXXXXXXXXXXXXXX 181 ++K S+SRSSARSLPR+ DAR+SL Sbjct: 550 RNKRRSLSRSSARSLPRRSISRSPVRSFRRRSPSRSPVRDARRSLSRSPVRSSRRSASRS 609 Query: 182 XXXXXXXXXXXXXXXXXXALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYR 361 ALSPPSNRGRS SRSASPDGSPKRI+RGRGFS +YSYARRYR Sbjct: 610 PVRRRTRRSISRSPVSRRALSPPSNRGRSFSRSASPDGSPKRIQRGRGFSEKYSYARRYR 669 Query: 362 TPSPDRSPVRSHRYGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 541 T SPDRSP+RSHRYGG Sbjct: 670 TRSPDRSPIRSHRYGGRTDRDRYSSYRRYHERSPPRRYRSPPRGRTPPSRYRSRRSHTRS 729 Query: 542 XXXXXIGYRGRRSPVRSRS 598 +GYRGRRSP+R RS Sbjct: 730 ISRSPVGYRGRRSPLRLRS 748 >ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] ref|XP_010925251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] ref|XP_010925252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] Length = 842 Score = 117 bits (292), Expect = 9e-27 Identities = 55/58 (94%), Positives = 56/58 (96%) Frame = +2 Query: 236 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 ALSPPSN GRSLSRSASPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 630 ALSPPSNHGRSLSRSASPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGG 687 >ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Phoenix dactylifera] ref|XP_017697447.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Phoenix dactylifera] Length = 818 Score = 115 bits (288), Expect = 3e-26 Identities = 54/58 (93%), Positives = 55/58 (94%) Frame = +2 Query: 236 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 ALSPPSN GRSLSRS SPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 606 ALSPPSNHGRSLSRSTSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGG 663 >ref|XP_010914921.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Elaeis guineensis] Length = 726 Score = 112 bits (280), Expect = 4e-25 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = +2 Query: 236 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 A+SPPSN RSLSRS SPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 516 AISPPSNHNRSLSRSVSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGG 573 >ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Elaeis guineensis] Length = 836 Score = 112 bits (280), Expect = 4e-25 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = +2 Query: 236 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 A+SPPSN RSLSRS SPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 626 AISPPSNHNRSLSRSVSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGG 683 >ref|XP_021275810.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X4 [Herrania umbratica] ref|XP_021275811.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X4 [Herrania umbratica] Length = 723 Score = 110 bits (276), Expect = 1e-24 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 526 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGG 581 >ref|XP_021275807.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Herrania umbratica] ref|XP_021275808.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Herrania umbratica] ref|XP_021275809.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Herrania umbratica] Length = 833 Score = 110 bits (276), Expect = 1e-24 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 636 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGG 691 >ref|XP_021275806.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Herrania umbratica] Length = 843 Score = 110 bits (276), Expect = 1e-24 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 646 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGG 701 >ref|XP_021275805.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Herrania umbratica] Length = 848 Score = 110 bits (276), Expect = 1e-24 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 651 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGG 706 >ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Musa acuminata subsp. malaccensis] Length = 819 Score = 110 bits (275), Expect = 2e-24 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +2 Query: 236 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 A+SPPSN RSLSRSASPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSP+R HRYGG Sbjct: 613 AISPPSNHRRSLSRSASPDGSPKRIRRGRGFSQQYSYARRYRTPSPDRSPIRLHRYGG 670 >ref|XP_020087995.1| peptidyl-prolyl cis-trans isomerase CYP95 [Ananas comosus] ref|XP_020087996.1| peptidyl-prolyl cis-trans isomerase CYP95 [Ananas comosus] gb|OAY82935.1| Peptidyl-prolyl cis-trans isomerase CYP63 [Ananas comosus] Length = 826 Score = 110 bits (274), Expect = 2e-24 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = +2 Query: 236 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 A+SPP NRGRSLSRS SPDGSPKRIRRGRGFS RYSYARRYRTPSP+RSPVRS+R+GG Sbjct: 619 AVSPPVNRGRSLSRSGSPDGSPKRIRRGRGFSQRYSYARRYRTPSPERSPVRSYRFGG 676 >ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Musa acuminata subsp. malaccensis] Length = 832 Score = 108 bits (270), Expect = 8e-24 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = +2 Query: 236 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 A SPPSNR RSLSRS SPDGSPKRIRRGRGFS +YS+ARRYRTPSPDRSPVR HRYGG Sbjct: 610 AASPPSNRRRSLSRSVSPDGSPKRIRRGRGFSQQYSFARRYRTPSPDRSPVRLHRYGG 667 >gb|EOY31440.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 5, partial [Theobroma cacao] Length = 579 Score = 107 bits (268), Expect = 1e-23 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 380 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 435 >gb|EOY31437.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 2 [Theobroma cacao] Length = 733 Score = 107 bits (268), Expect = 1e-23 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 532 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 587 >ref|XP_017983288.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Theobroma cacao] ref|XP_017983289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Theobroma cacao] Length = 735 Score = 107 bits (268), Expect = 1e-23 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 532 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 587 >gb|OVA00494.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain [Macleaya cordata] Length = 811 Score = 107 bits (268), Expect = 2e-23 Identities = 53/57 (92%), Positives = 54/57 (94%), Gaps = 1/57 (1%) Frame = +2 Query: 242 SPPSN-RGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SP SN RGRSLSRSASPDGSPKRIRRGRGFS RYSYARRYRTPSP+RSPVRSHRYGG Sbjct: 621 SPVSNHRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPERSPVRSHRYGG 677 >gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma cacao] gb|EOY31438.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma cacao] Length = 843 Score = 107 bits (268), Expect = 2e-23 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 642 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 697 >ref|XP_007013817.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Theobroma cacao] ref|XP_017983287.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Theobroma cacao] Length = 845 Score = 107 bits (268), Expect = 2e-23 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 642 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 697 >gb|EOY31439.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma cacao] Length = 858 Score = 107 bits (268), Expect = 2e-23 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 657 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 712 >ref|XP_007013820.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Theobroma cacao] Length = 860 Score = 107 bits (268), Expect = 2e-23 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = +2 Query: 242 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 409 SPPSNRGRSLSRS SPD SPKRIRRGRGFS RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 657 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 712