BLASTX nr result
ID: Ophiopogon25_contig00014013
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00014013 (397 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009381071.1| PREDICTED: very-long-chain enoyl-CoA reducta... 84 8e-17 gb|ABR25654.1| synaptic glycoprotein sc2, partial [Oryza sativa ... 79 1e-16 ref|XP_018814522.1| PREDICTED: very-long-chain enoyl-CoA reducta... 84 2e-16 ref|XP_011027192.1| PREDICTED: very-long-chain enoyl-CoA reducta... 84 2e-16 ref|XP_002316290.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family... 84 2e-16 ref|XP_012842513.1| PREDICTED: very-long-chain enoyl-CoA reducta... 84 2e-16 gb|KOM46725.1| hypothetical protein LR48_Vigan07g042900 [Vigna a... 79 2e-16 gb|KDO67625.1| hypothetical protein CISIN_1g043518mg, partial [C... 82 3e-16 ref|XP_009403446.1| PREDICTED: very-long-chain enoyl-CoA reducta... 83 3e-16 gb|AFK46411.1| unknown [Lotus japonicus] 80 3e-16 gb|POE75407.1| very-long-chain enoyl-coa reductase [Quercus suber] 82 4e-16 ref|XP_023514664.1| very-long-chain enoyl-CoA reductase-like [Cu... 82 4e-16 ref|XP_012089325.1| very-long-chain enoyl-CoA reductase [Jatroph... 82 4e-16 gb|ABK26395.1| unknown [Picea sitchensis] 82 4e-16 gb|PPR89586.1| hypothetical protein GOBAR_AA31102 [Gossypium bar... 82 4e-16 gb|PON33839.1| 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal... 82 4e-16 gb|PKI72383.1| hypothetical protein CRG98_007253 [Punica granatum] 82 4e-16 ref|XP_021659235.1| very-long-chain enoyl-CoA reductase-like iso... 82 4e-16 ref|XP_021659236.1| very-long-chain enoyl-CoA reductase-like iso... 82 4e-16 dbj|GAV69470.1| Steroid_dh domain-containing protein [Cephalotus... 82 4e-16 >ref|XP_009381071.1| PREDICTED: very-long-chain enoyl-CoA reductase-like [Musa acuminata subsp. malaccensis] Length = 310 Score = 84.3 bits (207), Expect = 8e-17 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI Sbjct: 274 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 310 >gb|ABR25654.1| synaptic glycoprotein sc2, partial [Oryza sativa Indica Group] Length = 110 Score = 79.3 bits (194), Expect = 1e-16 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWAL KHRRLKKLFDGK+GRP+YPRRWVILPPF+ Sbjct: 74 IMTNWALGKHRRLKKLFDGKEGRPKYPRRWVILPPFL 110 >ref|XP_018814522.1| PREDICTED: very-long-chain enoyl-CoA reductase-like [Juglans regia] Length = 310 Score = 83.6 bits (205), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPF+ Sbjct: 274 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFL 310 >ref|XP_011027192.1| PREDICTED: very-long-chain enoyl-CoA reductase-like [Populus euphratica] Length = 310 Score = 83.6 bits (205), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPF+ Sbjct: 274 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFL 310 >ref|XP_002316290.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Populus trichocarpa] gb|PNT17721.1| hypothetical protein POPTR_010G204400v3 [Populus trichocarpa] Length = 310 Score = 83.6 bits (205), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPF+ Sbjct: 274 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFL 310 >ref|XP_012842513.1| PREDICTED: very-long-chain enoyl-CoA reductase [Erythranthe guttata] gb|EYU33200.1| hypothetical protein MIMGU_mgv1a010470mg [Erythranthe guttata] Length = 311 Score = 83.6 bits (205), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPF+ Sbjct: 275 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFL 311 >gb|KOM46725.1| hypothetical protein LR48_Vigan07g042900 [Vigna angularis] Length = 115 Score = 79.3 bits (194), Expect = 2e-16 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWA AKHRRLKKLFDGKDG PRYPRRW+ILPPF+ Sbjct: 79 IMTNWAFAKHRRLKKLFDGKDGSPRYPRRWIILPPFL 115 >gb|KDO67625.1| hypothetical protein CISIN_1g043518mg, partial [Citrus sinensis] Length = 273 Score = 82.4 bits (202), Expect = 3e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRP+YPRRWVILPPF+ Sbjct: 237 IMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 273 >ref|XP_009403446.1| PREDICTED: very-long-chain enoyl-CoA reductase [Musa acuminata subsp. malaccensis] Length = 310 Score = 82.8 bits (203), Expect = 3e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGK+GRPRYPRRWVILPPFI Sbjct: 274 IMTNWALAKHRRLKKLFDGKEGRPRYPRRWVILPPFI 310 >gb|AFK46411.1| unknown [Lotus japonicus] Length = 188 Score = 80.5 bits (197), Expect = 3e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWAL KHRRLKKLFDGK+GRPRYPRRWVILPPF+ Sbjct: 152 IMTNWALTKHRRLKKLFDGKEGRPRYPRRWVILPPFL 188 >gb|POE75407.1| very-long-chain enoyl-coa reductase [Quercus suber] Length = 268 Score = 82.0 bits (201), Expect = 4e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGK+GRPRYPRRWVILPPF+ Sbjct: 232 IMTNWALAKHRRLKKLFDGKEGRPRYPRRWVILPPFL 268 >ref|XP_023514664.1| very-long-chain enoyl-CoA reductase-like [Cucurbita pepo subsp. pepo] Length = 278 Score = 82.0 bits (201), Expect = 4e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGK+GRPRYPRRWVILPPF+ Sbjct: 242 IMTNWALAKHRRLKKLFDGKEGRPRYPRRWVILPPFL 278 >ref|XP_012089325.1| very-long-chain enoyl-CoA reductase [Jatropha curcas] gb|KDP44963.1| hypothetical protein JCGZ_01463 [Jatropha curcas] Length = 308 Score = 82.4 bits (202), Expect = 4e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRP+YPRRWVILPPF+ Sbjct: 272 IMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 308 >gb|ABK26395.1| unknown [Picea sitchensis] Length = 308 Score = 82.4 bits (202), Expect = 4e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRP+YPRRWVILPPF+ Sbjct: 272 IMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 308 >gb|PPR89586.1| hypothetical protein GOBAR_AA31102 [Gossypium barbadense] Length = 309 Score = 82.4 bits (202), Expect = 4e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRP+YPRRWVILPPF+ Sbjct: 273 IMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 309 >gb|PON33839.1| 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal [Parasponia andersonii] Length = 310 Score = 82.4 bits (202), Expect = 4e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRP+YPRRWVILPPF+ Sbjct: 274 IMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 310 >gb|PKI72383.1| hypothetical protein CRG98_007253 [Punica granatum] Length = 310 Score = 82.4 bits (202), Expect = 4e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRP+YPRRWVILPPF+ Sbjct: 274 IMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 310 >ref|XP_021659235.1| very-long-chain enoyl-CoA reductase-like isoform X1 [Hevea brasiliensis] ref|XP_021659238.1| very-long-chain enoyl-CoA reductase-like isoform X1 [Hevea brasiliensis] Length = 310 Score = 82.4 bits (202), Expect = 4e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRP+YPRRWVILPPF+ Sbjct: 274 IMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 310 >ref|XP_021659236.1| very-long-chain enoyl-CoA reductase-like isoform X2 [Hevea brasiliensis] ref|XP_021659237.1| very-long-chain enoyl-CoA reductase-like isoform X2 [Hevea brasiliensis] Length = 310 Score = 82.4 bits (202), Expect = 4e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRP+YPRRWVILPPF+ Sbjct: 274 IMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 310 >dbj|GAV69470.1| Steroid_dh domain-containing protein [Cephalotus follicularis] Length = 310 Score = 82.4 bits (202), Expect = 4e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 2 IMTNWALAKHRRLKKLFDGKDGRPRYPRRWVILPPFI 112 IMTNWALAKHRRLKKLFDGKDGRP+YPRRWVILPPF+ Sbjct: 274 IMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 310