BLASTX nr result
ID: Ophiopogon25_contig00013939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00013939 (621 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHF99461.1| Transport particle 20 kDa subunit [Gossypium arbo... 65 8e-11 emb|CDY39971.1| BnaC06g40490D [Brassica napus] 65 1e-10 ref|XP_015890829.1| PREDICTED: trafficking protein particle comp... 65 2e-10 gb|PNT46284.1| hypothetical protein POPTR_003G183400v3 [Populus ... 65 2e-10 emb|CDY29105.1| BnaC09g18310D [Brassica napus] 64 2e-10 gb|OAY76879.1| Transport protein particle 20 kDa subunit, partia... 65 3e-10 gb|ESQ39551.1| hypothetical protein EUTSA_v10001067mg [Eutrema s... 65 3e-10 ref|XP_020259110.1| trafficking protein particle complex subunit... 65 3e-10 gb|PHU15225.1| hypothetical protein BC332_16430 [Capsicum chinense] 65 3e-10 gb|KJB29969.1| hypothetical protein B456_005G125900 [Gossypium r... 65 3e-10 ref|XP_022761590.1| trafficking protein particle complex subunit... 65 3e-10 emb|CDP08750.1| unnamed protein product [Coffea canephora] 63 5e-10 ref|XP_021911004.1| trafficking protein particle complex subunit... 65 5e-10 gb|PIA44961.1| hypothetical protein AQUCO_01700497v1 [Aquilegia ... 65 6e-10 ref|XP_024023137.1| trafficking protein particle complex subunit... 65 6e-10 gb|PIA44958.1| hypothetical protein AQUCO_01700497v1 [Aquilegia ... 65 6e-10 ref|XP_022761589.1| trafficking protein particle complex subunit... 65 6e-10 ref|XP_020594245.1| trafficking protein particle complex subunit... 65 6e-10 ref|XP_020105622.1| trafficking protein particle complex subunit... 65 6e-10 ref|XP_016741851.1| PREDICTED: trafficking protein particle comp... 65 6e-10 >gb|KHF99461.1| Transport particle 20 kDa subunit [Gossypium arboreum] Length = 55 Score = 65.1 bits (157), Expect = 8e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 24 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 55 >emb|CDY39971.1| BnaC06g40490D [Brassica napus] Length = 55 Score = 64.7 bits (156), Expect = 1e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IK+LLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 24 IKVLLNPLYLPGSRITSSHFDTKVRALARKYL 55 >ref|XP_015890829.1| PREDICTED: trafficking protein particle complex subunit 2 [Ziziphus jujuba] Length = 80 Score = 64.7 bits (156), Expect = 2e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IK+LLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 49 IKVLLNPLYLPGSRITSSHFDTKVRALARKYL 80 >gb|PNT46284.1| hypothetical protein POPTR_003G183400v3 [Populus trichocarpa] Length = 94 Score = 65.1 bits (157), Expect = 2e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 63 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 94 >emb|CDY29105.1| BnaC09g18310D [Brassica napus] Length = 55 Score = 63.9 bits (154), Expect = 2e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITS+HFDTKVRALARKYL Sbjct: 24 IKILLNPLYLPGSRITSTHFDTKVRALARKYL 55 >gb|OAY76879.1| Transport protein particle 20 kDa subunit, partial [Ananas comosus] Length = 106 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 75 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 106 >gb|ESQ39551.1| hypothetical protein EUTSA_v10001067mg [Eutrema salsugineum] Length = 107 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 76 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 107 >ref|XP_020259110.1| trafficking protein particle complex subunit 2, partial [Asparagus officinalis] Length = 109 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 78 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 109 >gb|PHU15225.1| hypothetical protein BC332_16430 [Capsicum chinense] Length = 110 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 79 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 110 >gb|KJB29969.1| hypothetical protein B456_005G125900 [Gossypium raimondii] Length = 110 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 79 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 110 >ref|XP_022761590.1| trafficking protein particle complex subunit 2-like isoform X2 [Durio zibethinus] Length = 112 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 81 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 112 >emb|CDP08750.1| unnamed protein product [Coffea canephora] Length = 55 Score = 63.2 bits (152), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IK LLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 24 IKTLLNPLYLPGSRITSSHFDTKVRALARKYL 55 >ref|XP_021911004.1| trafficking protein particle complex subunit 2, partial [Carica papaya] Length = 117 Score = 64.7 bits (156), Expect = 5e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 +KILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 86 VKILLNPLYLPGSRITSSHFDTKVRALARKYL 117 >gb|PIA44961.1| hypothetical protein AQUCO_01700497v1 [Aquilegia coerulea] Length = 134 Score = 65.1 bits (157), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 103 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 134 >ref|XP_024023137.1| trafficking protein particle complex subunit 2 [Morus notabilis] ref|XP_024023138.1| trafficking protein particle complex subunit 2 [Morus notabilis] Length = 135 Score = 65.1 bits (157), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 104 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 135 >gb|PIA44958.1| hypothetical protein AQUCO_01700497v1 [Aquilegia coerulea] gb|PIA44959.1| hypothetical protein AQUCO_01700497v1 [Aquilegia coerulea] Length = 135 Score = 65.1 bits (157), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 104 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 135 >ref|XP_022761589.1| trafficking protein particle complex subunit 2-like isoform X1 [Durio zibethinus] Length = 135 Score = 65.1 bits (157), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 104 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 135 >ref|XP_020594245.1| trafficking protein particle complex subunit 2-like [Phalaenopsis equestris] Length = 135 Score = 65.1 bits (157), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 104 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 135 >ref|XP_020105622.1| trafficking protein particle complex subunit 2-like [Ananas comosus] ref|XP_020105623.1| trafficking protein particle complex subunit 2-like [Ananas comosus] Length = 135 Score = 65.1 bits (157), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 104 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 135 >ref|XP_016741851.1| PREDICTED: trafficking protein particle complex subunit 2-like [Gossypium hirsutum] Length = 135 Score = 65.1 bits (157), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IKILLNPLYVPGSRITSSHFDTKVRALARKYL 96 IKILLNPLY+PGSRITSSHFDTKVRALARKYL Sbjct: 104 IKILLNPLYLPGSRITSSHFDTKVRALARKYL 135