BLASTX nr result
ID: Ophiopogon25_contig00013413
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00013413 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009602197.1| PREDICTED: H/ACA ribonucleoprotein complex s... 80 3e-17 ref|XP_019242052.1| PREDICTED: H/ACA ribonucleoprotein complex s... 79 5e-17 ref|XP_009800512.1| PREDICTED: H/ACA ribonucleoprotein complex s... 79 7e-17 gb|PON81757.1| H/ACA ribonucleoprotein complex, subunit Nop [Tre... 79 1e-16 gb|PON62651.1| H/ACA ribonucleoprotein complex, subunit Nop [Par... 79 1e-16 gb|OIW19362.1| hypothetical protein TanjilG_03496 [Lupinus angus... 79 1e-16 gb|OIV99730.1| hypothetical protein TanjilG_26068 [Lupinus angus... 79 1e-16 ref|XP_021632290.1| H/ACA ribonucleoprotein complex subunit 3-li... 79 1e-16 ref|XP_016683532.1| PREDICTED: H/ACA ribonucleoprotein complex s... 79 1e-16 ref|XP_016566455.1| PREDICTED: H/ACA ribonucleoprotein complex s... 79 1e-16 ref|XP_012452536.1| PREDICTED: H/ACA ribonucleoprotein complex s... 79 1e-16 ref|XP_010044801.1| PREDICTED: H/ACA ribonucleoprotein complex s... 79 1e-16 ref|XP_016466254.1| PREDICTED: H/ACA ribonucleoprotein complex s... 79 1e-16 ref|XP_009608322.1| PREDICTED: H/ACA ribonucleoprotein complex s... 79 1e-16 gb|KJB66950.1| hypothetical protein B456_010G167900, partial [Go... 79 2e-16 ref|XP_020694662.1| H/ACA ribonucleoprotein complex subunit 3-li... 78 2e-16 ref|XP_006443812.1| H/ACA ribonucleoprotein complex subunit 3-li... 78 2e-16 gb|KCW88531.1| hypothetical protein EUGRSUZ_A00909, partial [Euc... 79 2e-16 ref|XP_020277054.1| H/ACA ribonucleoprotein complex subunit 3-li... 78 3e-16 ref|XP_010262350.1| PREDICTED: H/ACA ribonucleoprotein complex s... 78 3e-16 >ref|XP_009602197.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana tomentosiformis] ref|XP_009779380.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana sylvestris] ref|XP_016432288.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana tabacum] ref|XP_018626742.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana tomentosiformis] Length = 64 Score = 80.5 bits (197), Expect = 3e-17 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 64 >ref|XP_019242052.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana attenuata] Length = 48 Score = 79.3 bits (194), Expect = 5e-17 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 +SAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY Sbjct: 12 ESAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 48 >ref|XP_009800512.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana sylvestris] ref|XP_016480213.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana tabacum] ref|XP_019250037.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana attenuata] Length = 64 Score = 79.3 bits (194), Expect = 7e-17 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 +SAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY Sbjct: 28 ESAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 64 >gb|PON81757.1| H/ACA ribonucleoprotein complex, subunit Nop [Trema orientalis] Length = 64 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQQPPQKY 64 >gb|PON62651.1| H/ACA ribonucleoprotein complex, subunit Nop [Parasponia andersonii] Length = 64 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQQPPQKY 64 >gb|OIW19362.1| hypothetical protein TanjilG_03496 [Lupinus angustifolius] Length = 64 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQQPPQKY 64 >gb|OIV99730.1| hypothetical protein TanjilG_26068 [Lupinus angustifolius] Length = 64 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQQPPQKY 64 >ref|XP_021632290.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Manihot esculenta] ref|XP_021632291.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Manihot esculenta] gb|OAY32655.1| hypothetical protein MANES_13G035600 [Manihot esculenta] Length = 64 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQQPPQKY 64 >ref|XP_016683532.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Gossypium hirsutum] ref|XP_016683533.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Gossypium hirsutum] Length = 64 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQQPPQKY 64 >ref|XP_016566455.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Capsicum annuum] ref|XP_016572119.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Capsicum annuum] gb|PHT27858.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum baccatum] gb|PHT54274.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum baccatum] gb|PHT80847.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum annuum] gb|PHT85515.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum annuum] gb|PHU16957.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum chinense] gb|PHU21474.1| H/ACA ribonucleoprotein complex subunit 3 [Capsicum chinense] Length = 64 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDK+SRQRVLLKKRFGLLPTQKPPQKY Sbjct: 28 QSAHPARFSPDDKFSRQRVLLKKRFGLLPTQKPPQKY 64 >ref|XP_012452536.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Gossypium raimondii] ref|XP_012452537.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Gossypium raimondii] gb|KJB66951.1| hypothetical protein B456_010G167900 [Gossypium raimondii] gb|KJB66952.1| hypothetical protein B456_010G167900 [Gossypium raimondii] Length = 64 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQQPPQKY 64 >ref|XP_010044801.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Eucalyptus grandis] Length = 64 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQQPPQKY 64 >ref|XP_016466254.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nicotiana tabacum] Length = 87 Score = 79.3 bits (194), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 +SAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY Sbjct: 51 ESAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 87 >ref|XP_009608322.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein isoform X2 [Nicotiana tomentosiformis] Length = 87 Score = 79.3 bits (194), Expect = 1e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 +SAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY Sbjct: 51 ESAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 87 >gb|KJB66950.1| hypothetical protein B456_010G167900, partial [Gossypium raimondii] Length = 86 Score = 79.0 bits (193), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 50 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQQPPQKY 86 >ref|XP_020694662.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Dendrobium catenatum] ref|XP_020694663.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Dendrobium catenatum] gb|PKU82195.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Dendrobium catenatum] Length = 64 Score = 78.2 bits (191), Expect = 2e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 394 VLFQSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 V +SAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQ+Y Sbjct: 25 VATESAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQQY 64 >ref|XP_006443812.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Citrus clementina] ref|XP_006479514.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Citrus sinensis] gb|ESR57052.1| hypothetical protein CICLE_v10023246mg [Citrus clementina] Length = 64 Score = 78.2 bits (191), Expect = 2e-16 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPP KY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPPKY 64 >gb|KCW88531.1| hypothetical protein EUGRSUZ_A00909, partial [Eucalyptus grandis] Length = 95 Score = 79.0 bits (193), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQ+PPQKY Sbjct: 59 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQQPPQKY 95 >ref|XP_020277054.1| H/ACA ribonucleoprotein complex subunit 3-like protein [Asparagus officinalis] Length = 64 Score = 77.8 bits (190), Expect = 3e-16 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPP KY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPLKY 64 >ref|XP_010262350.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 3-like protein [Nelumbo nucifera] Length = 64 Score = 77.8 bits (190), Expect = 3e-16 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 385 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPQKY 275 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPP KY Sbjct: 28 QSAHPARFSPDDKYSRQRVLLKKRFGLLPTQKPPLKY 64