BLASTX nr result
ID: Ophiopogon25_contig00013404
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00013404 (535 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259328.1| NEDD8 ultimate buster 1 [Asparagus officinal... 72 2e-11 ref|XP_020589026.1| NEDD8 ultimate buster 1 isoform X2 [Phalaeno... 71 4e-11 ref|XP_020589025.1| NEDD8 ultimate buster 1 isoform X1 [Phalaeno... 71 4e-11 ref|XP_020083129.1| NEDD8 ultimate buster 1 [Ananas comosus] 70 9e-11 gb|OAY85886.1| NEDD8 ultimate buster 1, partial [Ananas comosus] 70 9e-11 ref|XP_009406655.1| PREDICTED: NEDD8 ultimate buster 1 [Musa acu... 70 9e-11 gb|KDO73413.1| hypothetical protein CISIN_1g014748mg [Citrus sin... 69 1e-10 gb|KDO73411.1| hypothetical protein CISIN_1g014748mg [Citrus sin... 69 2e-10 dbj|GAY37365.1| hypothetical protein CUMW_028450 [Citrus unshiu] 69 2e-10 dbj|GAY37366.1| hypothetical protein CUMW_028450 [Citrus unshiu] 69 2e-10 gb|PKA51493.1| hypothetical protein AXF42_Ash002858 [Apostasia s... 69 2e-10 ref|XP_010907620.1| PREDICTED: NEDD8 ultimate buster 1 [Elaeis g... 69 2e-10 ref|XP_006453132.1| NEDD8 ultimate buster 1 [Citrus clementina] ... 68 6e-10 ref|XP_010244884.1| PREDICTED: NEDD8 ultimate buster 1 [Nelumbo ... 67 8e-10 ref|XP_006852823.1| NEDD8 ultimate buster 1 [Amborella trichopod... 67 1e-09 gb|EEF35116.1| conserved hypothetical protein [Ricinus communis] 61 3e-09 ref|XP_009387613.1| PREDICTED: uncharacterized protein LOC103974... 62 3e-09 ref|XP_004294681.1| PREDICTED: NEDD8 ultimate buster 1-like [Fra... 65 7e-09 dbj|GAQ87340.1| protein with Ubiquitin associated domain [Klebso... 63 1e-08 ref|XP_008801924.1| PREDICTED: NEDD8 ultimate buster 1 [Phoenix ... 64 1e-08 >ref|XP_020259328.1| NEDD8 ultimate buster 1 [Asparagus officinalis] ref|XP_020259329.1| NEDD8 ultimate buster 1 [Asparagus officinalis] Length = 398 Score = 72.0 bits (175), Expect = 2e-11 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 76 DVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDSTVQLENGSS 222 D EME+EL++ L+GD +ADYDIEVTKEGEAIAEYL+LLDS+ Q GSS Sbjct: 348 DFEMEDELIRNLKGDAIADYDIEVTKEGEAIAEYLSLLDSSGQQSIGSS 396 >ref|XP_020589026.1| NEDD8 ultimate buster 1 isoform X2 [Phalaenopsis equestris] Length = 521 Score = 71.2 bits (173), Expect = 4e-11 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = +1 Query: 73 RDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDSTVQLENGSS 222 RD EME+EL K+L GD ADYD+EV+KEGEAIAEYLALL+S+ ++ GSS Sbjct: 472 RDEEMEDELAKELTGDAYADYDLEVSKEGEAIAEYLALLESSTSMKTGSS 521 >ref|XP_020589025.1| NEDD8 ultimate buster 1 isoform X1 [Phalaenopsis equestris] Length = 522 Score = 71.2 bits (173), Expect = 4e-11 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = +1 Query: 73 RDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDSTVQLENGSS 222 RD EME+EL K+L GD ADYD+EV+KEGEAIAEYLALL+S+ ++ GSS Sbjct: 473 RDEEMEDELAKELTGDAYADYDLEVSKEGEAIAEYLALLESSTSMKTGSS 522 >ref|XP_020083129.1| NEDD8 ultimate buster 1 [Ananas comosus] Length = 559 Score = 70.1 bits (170), Expect = 9e-11 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +1 Query: 64 RSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDST 198 +S RDVEME+EL KL GDP ADYDIEV +EGEAIAEY++LL+ST Sbjct: 511 KSGRDVEMEDELADKLTGDPFADYDIEVAREGEAIAEYMSLLEST 555 >gb|OAY85886.1| NEDD8 ultimate buster 1, partial [Ananas comosus] Length = 561 Score = 70.1 bits (170), Expect = 9e-11 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +1 Query: 64 RSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDST 198 +S RDVEME+EL KL GDP ADYDIEV +EGEAIAEY++LL+ST Sbjct: 513 KSGRDVEMEDELADKLTGDPFADYDIEVAREGEAIAEYMSLLEST 557 >ref|XP_009406655.1| PREDICTED: NEDD8 ultimate buster 1 [Musa acuminata subsp. malaccensis] Length = 568 Score = 70.1 bits (170), Expect = 9e-11 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +1 Query: 52 GEDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 GE+ + RD ME+EL K+L GDPLADYD+EV KEGEAIAEYLALLDS Sbjct: 516 GEEHKYPRDEVMEDELAKELTGDPLADYDMEVMKEGEAIAEYLALLDS 563 >gb|KDO73413.1| hypothetical protein CISIN_1g014748mg [Citrus sinensis] Length = 365 Score = 69.3 bits (168), Expect = 1e-10 Identities = 37/51 (72%), Positives = 40/51 (78%) Frame = +1 Query: 43 TSGGEDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 TS EDV R DVEME+EL L GD ADYDIEVTKEGEAI+EYL+LLDS Sbjct: 305 TSATEDVNGR-DVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDS 354 >gb|KDO73411.1| hypothetical protein CISIN_1g014748mg [Citrus sinensis] Length = 419 Score = 69.3 bits (168), Expect = 2e-10 Identities = 37/51 (72%), Positives = 40/51 (78%) Frame = +1 Query: 43 TSGGEDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 TS EDV R DVEME+EL L GD ADYDIEVTKEGEAI+EYL+LLDS Sbjct: 359 TSATEDVNGR-DVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDS 408 >dbj|GAY37365.1| hypothetical protein CUMW_028450 [Citrus unshiu] Length = 464 Score = 69.3 bits (168), Expect = 2e-10 Identities = 37/51 (72%), Positives = 40/51 (78%) Frame = +1 Query: 43 TSGGEDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 TS EDV R DVEME+EL L GD ADYDIEVTKEGEAI+EYL+LLDS Sbjct: 404 TSATEDVNGR-DVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDS 453 >dbj|GAY37366.1| hypothetical protein CUMW_028450 [Citrus unshiu] Length = 506 Score = 69.3 bits (168), Expect = 2e-10 Identities = 37/51 (72%), Positives = 40/51 (78%) Frame = +1 Query: 43 TSGGEDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 TS EDV R DVEME+EL L GD ADYDIEVTKEGEAI+EYL+LLDS Sbjct: 446 TSATEDVNGR-DVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDS 495 >gb|PKA51493.1| hypothetical protein AXF42_Ash002858 [Apostasia shenzhenica] Length = 475 Score = 68.9 bits (167), Expect = 2e-10 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 49 GGEDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 GG+D RD EME+EL K+LRGD ADYD+EV+KEGEAIAEYLALL+S Sbjct: 397 GGDD----RDEEMEDELAKELRGDAFADYDLEVSKEGEAIAEYLALLES 441 >ref|XP_010907620.1| PREDICTED: NEDD8 ultimate buster 1 [Elaeis guineensis] Length = 537 Score = 68.9 bits (167), Expect = 2e-10 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +1 Query: 49 GGEDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 G E+ + RD ME E+ K+L GDPLADYDIEV KEGEA+AEY ALLDS Sbjct: 485 GEENYKFERDEAMEGEIAKELTGDPLADYDIEVAKEGEALAEYFALLDS 533 >ref|XP_006453132.1| NEDD8 ultimate buster 1 [Citrus clementina] ref|XP_006474370.1| PREDICTED: NEDD8 ultimate buster 1 [Citrus sinensis] gb|ESR66372.1| hypothetical protein CICLE_v10007887mg [Citrus clementina] Length = 561 Score = 67.8 bits (164), Expect = 6e-10 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = +1 Query: 43 TSGGEDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 TS EDV R DVEME+EL L GD ADYDIEVTKEGEAI+EYL+LL+S Sbjct: 501 TSATEDVNGR-DVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLES 550 >ref|XP_010244884.1| PREDICTED: NEDD8 ultimate buster 1 [Nelumbo nucifera] Length = 564 Score = 67.4 bits (163), Expect = 8e-10 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = +1 Query: 58 DVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDST 198 D RD+EME+ +V+++ GD L+DYDIEVTKEGEAIAEYLALL ST Sbjct: 509 DTTEERDMEMEDAIVQEITGDSLSDYDIEVTKEGEAIAEYLALLTST 555 >ref|XP_006852823.1| NEDD8 ultimate buster 1 [Amborella trichopoda] ref|XP_020528206.1| NEDD8 ultimate buster 1 [Amborella trichopoda] gb|ERN14290.1| hypothetical protein AMTR_s00033p00177630 [Amborella trichopoda] Length = 554 Score = 66.6 bits (161), Expect = 1e-09 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = +1 Query: 43 TSGGEDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDST 198 +S E + RD EME ELV++L DP ADYDI+VTKEGEA+AEY+ALL+ST Sbjct: 495 SSTNEAAQIIRDNEMEEELVQELTSDPFADYDIDVTKEGEAVAEYVALLNST 546 >gb|EEF35116.1| conserved hypothetical protein [Ricinus communis] Length = 80 Score = 61.2 bits (147), Expect = 3e-09 Identities = 31/51 (60%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = +1 Query: 73 RDVEMENELVKKL-RGDPLADYDIEVTKEGEAIAEYLALLDSTVQLENGSS 222 RDVEME+E+ +++ + D L+DYDI+VTKEGEAI EYLALLDS + SS Sbjct: 28 RDVEMEDEIAEQIAKADALSDYDIDVTKEGEAITEYLALLDSVRSSKRASS 78 >ref|XP_009387613.1| PREDICTED: uncharacterized protein LOC103974487, partial [Musa acuminata subsp. malaccensis] Length = 128 Score = 62.4 bits (150), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +1 Query: 49 GGEDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 GGE + RD +E+EL K+L GDPLADYD EV KEGEA A+YLALLDS Sbjct: 76 GGEH-KYERDEAVEDELAKELTGDPLADYDAEVMKEGEAKAKYLALLDS 123 >ref|XP_004294681.1| PREDICTED: NEDD8 ultimate buster 1-like [Fragaria vesca subsp. vesca] Length = 564 Score = 64.7 bits (156), Expect = 7e-09 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 49 GGEDVRSRRDVEMENELVKKL-RGDPLADYDIEVTKEGEAIAEYLALLDS 195 GG S RD EMENEL ++L + D L+DYD+EVTKEGEAI EYLALLDS Sbjct: 513 GGSSRASERDSEMENELAEELAQQDALSDYDLEVTKEGEAIGEYLALLDS 562 >dbj|GAQ87340.1| protein with Ubiquitin associated domain [Klebsormidium nitens] Length = 255 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = +1 Query: 55 EDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 ++ RRD EME+E+V+ + GDPLA YD++V+KEGE I EYLALL+S Sbjct: 202 DEPEERRDAEMEDEIVEGVTGDPLAQYDVDVSKEGEVIQEYLALLES 248 >ref|XP_008801924.1| PREDICTED: NEDD8 ultimate buster 1 [Phoenix dactylifera] Length = 454 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = +1 Query: 55 EDVRSRRDVEMENELVKKLRGDPLADYDIEVTKEGEAIAEYLALLDS 195 E RD ME E+ K+L GDPLADYDIEV KEGEA+ EY ALLDS Sbjct: 397 EKYEIERDEAMEGEIAKELTGDPLADYDIEVAKEGEALEEYFALLDS 443