BLASTX nr result
ID: Ophiopogon25_contig00013112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00013112 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU31347.1| hypothetical protein TSUD_315570 [Trifolium subt... 57 2e-06 >dbj|GAU31347.1| hypothetical protein TSUD_315570 [Trifolium subterraneum] Length = 238 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +1 Query: 25 DLEIERQLKLLNKPHIKSFKSDGYQSTGCYNLLCLGFVLTGTN 153 + EIE +LKLLNKP +KS + D Y+STGC++L C GFV T N Sbjct: 45 ETEIETKLKLLNKPAVKSIQRDSYKSTGCFDLTCHGFVQTNKN 87