BLASTX nr result
ID: Ophiopogon25_contig00013040
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00013040 (1380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK79192.1| uncharacterized protein A4U43_C01F3860 [Asparagus... 91 8e-17 ref|XP_020272605.1| splicing factor, suppressor of white-apricot... 91 1e-15 ref|XP_010923405.1| PREDICTED: splicing factor, suppressor of wh... 61 3e-06 ref|XP_010923396.1| PREDICTED: splicing factor, suppressor of wh... 61 3e-06 >gb|ONK79192.1| uncharacterized protein A4U43_C01F3860 [Asparagus officinalis] Length = 271 Score = 90.9 bits (224), Expect = 8e-17 Identities = 42/56 (75%), Positives = 48/56 (85%) Frame = -1 Query: 168 DAGTTERSEATGSGSYQAVPFSYGNNHGSADSNSCGPNHSAFHPPFSVPTGLLNHL 1 D TTERSEATGSGSYQAVPFSYGNN G AD NS G +HS++HPPFSVPT L+++L Sbjct: 88 DEETTERSEATGSGSYQAVPFSYGNNGGLADPNSYGQDHSSYHPPFSVPTSLISNL 143 >ref|XP_020272605.1| splicing factor, suppressor of white-apricot homolog [Asparagus officinalis] Length = 753 Score = 90.9 bits (224), Expect = 1e-15 Identities = 42/56 (75%), Positives = 48/56 (85%) Frame = -1 Query: 168 DAGTTERSEATGSGSYQAVPFSYGNNHGSADSNSCGPNHSAFHPPFSVPTGLLNHL 1 D TTERSEATGSGSYQAVPFSYGNN G AD NS G +HS++HPPFSVPT L+++L Sbjct: 88 DEETTERSEATGSGSYQAVPFSYGNNGGLADPNSYGQDHSSYHPPFSVPTSLISNL 143 >ref|XP_010923405.1| PREDICTED: splicing factor, suppressor of white-apricot homolog isoform X2 [Elaeis guineensis] Length = 879 Score = 61.2 bits (147), Expect = 3e-06 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -1 Query: 162 GTTERSEATGSGSYQAVPFSYGNNHGSADSNS--CGPNHSAFHPPFSVPTGLLNHL 1 GT EAT SG+YQAVPFSY + SAD + GPN S +HPPF VP LL++L Sbjct: 107 GTRNGPEATVSGAYQAVPFSYVDTDSSADPRNFGSGPNQSGYHPPFPVPESLLSNL 162 >ref|XP_010923396.1| PREDICTED: splicing factor, suppressor of white-apricot homolog isoform X1 [Elaeis guineensis] Length = 894 Score = 61.2 bits (147), Expect = 3e-06 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -1 Query: 162 GTTERSEATGSGSYQAVPFSYGNNHGSADSNS--CGPNHSAFHPPFSVPTGLLNHL 1 GT EAT SG+YQAVPFSY + SAD + GPN S +HPPF VP LL++L Sbjct: 107 GTRNGPEATVSGAYQAVPFSYVDTDSSADPRNFGSGPNQSGYHPPFPVPESLLSNL 162