BLASTX nr result
ID: Ophiopogon25_contig00012471
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00012471 (2521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK66216.1| uncharacterized protein A4U43_C06F5430 [Asparagus... 64 6e-07 ref|XP_020270593.1| cysteine-rich repeat secretory protein 12-li... 64 9e-07 ref|XP_009391415.1| PREDICTED: cysteine-rich repeat secretory pr... 60 4e-06 gb|OAY79303.1| hypothetical protein ACMD2_00024, partial [Ananas... 55 7e-06 >gb|ONK66216.1| uncharacterized protein A4U43_C06F5430 [Asparagus officinalis] Length = 327 Score = 63.5 bits (153), Expect = 6e-07 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = +2 Query: 2315 DNTEEAGKTLAIIIGLMAGVALIIVFASFLRRAGSSK 2425 ++TEEAGKTLAII+GL+AGVALIIVFASF+RRAGS+K Sbjct: 290 ESTEEAGKTLAIILGLIAGVALIIVFASFIRRAGSNK 326 >ref|XP_020270593.1| cysteine-rich repeat secretory protein 12-like [Asparagus officinalis] Length = 384 Score = 63.5 bits (153), Expect = 9e-07 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = +2 Query: 2315 DNTEEAGKTLAIIIGLMAGVALIIVFASFLRRAGSSK 2425 ++TEEAGKTLAII+GL+AGVALIIVFASF+RRAGS+K Sbjct: 347 ESTEEAGKTLAIILGLIAGVALIIVFASFIRRAGSNK 383 >ref|XP_009391415.1| PREDICTED: cysteine-rich repeat secretory protein 12 [Musa acuminata subsp. malaccensis] Length = 280 Score = 60.5 bits (145), Expect = 4e-06 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 2312 TDNTEEAGKTLAIIIGLMAGVALIIVFASFLRRAG 2416 TD+ +EAGKTLAIIIGLMAGVALIIVF SFLRRAG Sbjct: 241 TDHGDEAGKTLAIIIGLMAGVALIIVFLSFLRRAG 275 >gb|OAY79303.1| hypothetical protein ACMD2_00024, partial [Ananas comosus] Length = 91 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +2 Query: 2294 LTLFLLTDNTEEAGKTLAIIIGLMAGVALIIVFASFLRRAGSSK 2425 L + T +EAGKTLAIIIGLMA VALIIVF SF+RRAG+ + Sbjct: 12 LAYLVRTLGVDEAGKTLAIIIGLMAAVALIIVFLSFIRRAGNEE 55