BLASTX nr result
ID: Ophiopogon25_contig00012187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00012187 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK74327.1| uncharacterized protein A4U43_C03F5100 [Asparagus... 55 5e-07 >gb|ONK74327.1| uncharacterized protein A4U43_C03F5100 [Asparagus officinalis] Length = 140 Score = 55.5 bits (132), Expect = 5e-07 Identities = 29/35 (82%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = -1 Query: 392 EYVDGELIVTVPKGPA-ADEEEREEFGVGRLVLVQ 291 EYVDGELIV VPKG +EEEREEFGVGRLVLVQ Sbjct: 106 EYVDGELIVVVPKGAEDEEEEEREEFGVGRLVLVQ 140