BLASTX nr result
ID: Ophiopogon25_contig00012136
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00012136 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008388647.1| PREDICTED: cysteine synthase [Malus domestic... 57 9e-07 ref|XP_021891236.1| cysteine synthase-like [Carica papaya] 57 9e-07 dbj|BAA93051.1| cysteine synthase [Allium tuberosum] 57 1e-06 sp|P38076.1|CYSK_WHEAT RecName: Full=Cysteine synthase; AltName:... 57 2e-06 ref|XP_020162192.1| cysteine synthase [Aegilops tauschii subsp. ... 57 2e-06 gb|ABF98863.1| Cysteine synthase, putative, expressed [Oryza sat... 56 2e-06 gb|KDO53282.1| hypothetical protein CISIN_1g020528mg [Citrus sin... 56 2e-06 gb|KDO53280.1| hypothetical protein CISIN_1g020528mg [Citrus sin... 56 2e-06 ref|XP_006433058.1| cysteine synthase isoform X1 [Citrus clement... 56 2e-06 dbj|GAY54172.1| hypothetical protein CUMW_154630 [Citrus unshiu] 56 2e-06 gb|EMS62090.1| Cysteine synthase [Triticum urartu] 56 2e-06 ref|XP_018724134.1| PREDICTED: uncharacterized protein LOC104432... 54 3e-06 ref|XP_008779550.1| PREDICTED: cysteine synthase-like [Phoenix d... 56 3e-06 ref|XP_018724133.1| PREDICTED: cysteine synthase 1-like isoform ... 54 3e-06 ref|XP_020096195.1| cysteine synthase [Ananas comosus] >gi|10359... 56 3e-06 ref|XP_011090730.1| cysteine synthase isoform X1 [Sesamum indicu... 56 3e-06 ref|XP_010906459.1| PREDICTED: cysteine synthase [Elaeis guineen... 56 3e-06 ref|NP_001291337.1| cysteine synthase [Sesamum indicum] >gi|1582... 56 3e-06 ref|XP_008796758.1| PREDICTED: cysteine synthase [Phoenix dactyl... 56 3e-06 ref|XP_020259404.1| cysteine synthase isoform X2 [Asparagus offi... 55 4e-06 >ref|XP_008388647.1| PREDICTED: cysteine synthase [Malus domestica] ref|XP_009364552.1| PREDICTED: cysteine synthase [Pyrus x bretschneideri] Length = 325 Score = 57.4 bits (137), Expect = 9e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN+IDE IQVT Sbjct: 223 PHKIQGIGAGFIPGVLDVNLIDEVIQVT 250 >ref|XP_021891236.1| cysteine synthase-like [Carica papaya] Length = 217 Score = 56.6 bits (135), Expect = 9e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN++DET+QV+ Sbjct: 115 PHKIQGIGAGFIPGVLDVNLLDETVQVS 142 >dbj|BAA93051.1| cysteine synthase [Allium tuberosum] Length = 325 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN+IDET+QV+ Sbjct: 223 PHKIQGIGAGFIPGVLDVNLIDETLQVS 250 >sp|P38076.1|CYSK_WHEAT RecName: Full=Cysteine synthase; AltName: Full=CSase A; AltName: Full=O-acetylserine (thiol)-lyase; Short=OAS-TL A; AltName: Full=O-acetylserine sulfhydrylase dbj|BAA02438.1| O-acetylserine (thiol) lyase [Triticum aestivum] Length = 325 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDV+IIDETIQV+ Sbjct: 224 PHKIQGIGAGFIPGVLDVDIIDETIQVS 251 >ref|XP_020162192.1| cysteine synthase [Aegilops tauschii subsp. tauschii] Length = 325 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDV+IIDETIQV+ Sbjct: 224 PHKIQGIGAGFIPGVLDVDIIDETIQVS 251 >gb|ABF98863.1| Cysteine synthase, putative, expressed [Oryza sativa Japonica Group] Length = 259 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVTK 89 PHKIQGIGAGF+PGVLDVN++DE +QV+K Sbjct: 223 PHKIQGIGAGFVPGVLDVNLLDEVVQVSK 251 >gb|KDO53282.1| hypothetical protein CISIN_1g020528mg [Citrus sinensis] Length = 270 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN++DET+Q++ Sbjct: 168 PHKIQGIGAGFIPGVLDVNLLDETVQIS 195 >gb|KDO53280.1| hypothetical protein CISIN_1g020528mg [Citrus sinensis] Length = 325 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN++DET+Q++ Sbjct: 223 PHKIQGIGAGFIPGVLDVNLLDETVQIS 250 >ref|XP_006433058.1| cysteine synthase isoform X1 [Citrus clementina] ref|XP_006471739.1| PREDICTED: cysteine synthase [Citrus sinensis] gb|ESR46298.1| hypothetical protein CICLE_v10001835mg [Citrus clementina] Length = 325 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN++DET+Q++ Sbjct: 223 PHKIQGIGAGFIPGVLDVNLLDETVQIS 250 >dbj|GAY54172.1| hypothetical protein CUMW_154630 [Citrus unshiu] Length = 328 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN++DET+Q++ Sbjct: 226 PHKIQGIGAGFIPGVLDVNLLDETVQIS 253 >gb|EMS62090.1| Cysteine synthase [Triticum urartu] Length = 338 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQV 83 PHKIQGIGAGFIPGVLDV+IIDETIQV Sbjct: 224 PHKIQGIGAGFIPGVLDVDIIDETIQV 250 >ref|XP_018724134.1| PREDICTED: uncharacterized protein LOC104432381 isoform X4 [Eucalyptus grandis] Length = 148 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVTKL*LGYYLMDLCFYD 131 P+KIQGIGAG IPGVL+V++IDE IQVTK+ + +++ C YD Sbjct: 49 PYKIQGIGAGVIPGVLEVDLIDEVIQVTKV-ESFIIVEHCGYD 90 >ref|XP_008779550.1| PREDICTED: cysteine synthase-like [Phoenix dactylifera] Length = 298 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN+IDE IQV+ Sbjct: 223 PHKIQGIGAGFIPGVLDVNLIDEVIQVS 250 >ref|XP_018724133.1| PREDICTED: cysteine synthase 1-like isoform X3 [Eucalyptus grandis] Length = 158 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVTKL*LGYYLMDLCFYD 131 P+KIQGIGAG IPGVL+V++IDE IQVTK+ + +++ C YD Sbjct: 59 PYKIQGIGAGVIPGVLEVDLIDEVIQVTKV-ESFIIVEHCGYD 100 >ref|XP_020096195.1| cysteine synthase [Ananas comosus] gb|OAY68302.1| Cysteine synthase [Ananas comosus] Length = 325 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN+IDE IQV+ Sbjct: 223 PHKIQGIGAGFIPGVLDVNLIDEVIQVS 250 >ref|XP_011090730.1| cysteine synthase isoform X1 [Sesamum indicum] ref|XP_011090731.1| cysteine synthase isoform X1 [Sesamum indicum] Length = 325 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN+IDE IQV+ Sbjct: 223 PHKIQGIGAGFIPGVLDVNLIDEVIQVS 250 >ref|XP_010906459.1| PREDICTED: cysteine synthase [Elaeis guineensis] ref|XP_010906460.1| PREDICTED: cysteine synthase [Elaeis guineensis] ref|XP_010906461.1| PREDICTED: cysteine synthase [Elaeis guineensis] Length = 325 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN+IDE IQV+ Sbjct: 223 PHKIQGIGAGFIPGVLDVNLIDEVIQVS 250 >ref|NP_001291337.1| cysteine synthase [Sesamum indicum] gb|ABW24494.1| O-acetylserine(thiol)-lyase [Sesamum indicum] Length = 325 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN+IDE IQV+ Sbjct: 223 PHKIQGIGAGFIPGVLDVNLIDEVIQVS 250 >ref|XP_008796758.1| PREDICTED: cysteine synthase [Phoenix dactylifera] ref|XP_008796759.1| PREDICTED: cysteine synthase [Phoenix dactylifera] Length = 327 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN+IDE IQV+ Sbjct: 223 PHKIQGIGAGFIPGVLDVNLIDEVIQVS 250 >ref|XP_020259404.1| cysteine synthase isoform X2 [Asparagus officinalis] Length = 281 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 3 PHKIQGIGAGFIPGVLDVNIIDETIQVT 86 PHKIQGIGAGFIPGVLDVN+IDE +QV+ Sbjct: 179 PHKIQGIGAGFIPGVLDVNLIDEVVQVS 206