BLASTX nr result
ID: Ophiopogon25_contig00011984
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00011984 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK70396.1| uncharacterized protein A4U43_C05F33280 [Asparagu... 55 3e-06 ref|XP_020267023.1| peptidyl-prolyl cis-trans isomerase CYP28, c... 55 4e-06 >gb|ONK70396.1| uncharacterized protein A4U43_C05F33280 [Asparagus officinalis] Length = 229 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 5/61 (8%) Frame = +1 Query: 1 GTLSLCLSVNHDYDEIKFDPDYRNVEVL---NPSNC--LDDRPLRRRTMVKVMIIFKQIQ 165 GTLSLCLS N DYDEIK DPDYRNVE L P C LD++ + T+++ M + I Sbjct: 110 GTLSLCLSENDDYDEIKLDPDYRNVEFLVTTGPGPCPQLDNQNIVFGTVLEGMDVVTAIA 169 Query: 166 A 168 A Sbjct: 170 A 170 >ref|XP_020267023.1| peptidyl-prolyl cis-trans isomerase CYP28, chloroplastic, partial [Asparagus officinalis] Length = 247 Score = 54.7 bits (130), Expect = 4e-06 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 5/61 (8%) Frame = +1 Query: 1 GTLSLCLSVNHDYDEIKFDPDYRNVEVL---NPSNC--LDDRPLRRRTMVKVMIIFKQIQ 165 GTLSLCLS N DYDEIK DPDYRNVE L P C LD++ + T+++ M + I Sbjct: 128 GTLSLCLSENDDYDEIKLDPDYRNVEFLVTTGPGPCPQLDNQNIVFGTVLEGMDVVTAIA 187 Query: 166 A 168 A Sbjct: 188 A 188