BLASTX nr result
ID: Ophiopogon25_contig00011404
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00011404 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245528.1| nuclear speckle splicing regulatory protein ... 74 9e-13 gb|ONK57500.1| uncharacterized protein A4U43_C09F1140 [Asparagus... 74 2e-12 >ref|XP_020245528.1| nuclear speckle splicing regulatory protein 1-like [Asparagus officinalis] Length = 304 Score = 73.6 bits (179), Expect = 9e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 342 KRNTPEEEPPKQTAEVYKRGEDAVAAARERFLARKKAREQ 223 K T EEEPPKQTAEVYKRGEDAVAAARERFLARK+AREQ Sbjct: 264 KAETTEEEPPKQTAEVYKRGEDAVAAARERFLARKRAREQ 303 >gb|ONK57500.1| uncharacterized protein A4U43_C09F1140 [Asparagus officinalis] Length = 856 Score = 73.6 bits (179), Expect = 2e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 342 KRNTPEEEPPKQTAEVYKRGEDAVAAARERFLARKKAREQ 223 K T EEEPPKQTAEVYKRGEDAVAAARERFLARK+AREQ Sbjct: 264 KAETTEEEPPKQTAEVYKRGEDAVAAARERFLARKRAREQ 303