BLASTX nr result
ID: Ophiopogon25_contig00011358
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00011358 (711 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK63932.1| uncharacterized protein A4U43_C07F20400 [Asparagu... 65 1e-08 ref|XP_020273004.1| clathrin interactor EPSIN 2 [Asparagus offic... 65 2e-08 ref|XP_020265729.1| transcription initiation factor TFIID subuni... 60 9e-07 >gb|ONK63932.1| uncharacterized protein A4U43_C07F20400 [Asparagus officinalis] Length = 783 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -1 Query: 348 NRDNGGRVDEPSQDDRRLERKLSGQSPRPSIEAAVKDAHEHVQDGR 211 +R++GGR DEPSQ++ RLERKLS QSP PS EAA KD +HVQD R Sbjct: 240 SRNSGGRGDEPSQEESRLERKLSEQSPPPSYEAATKDTRDHVQDER 285 >ref|XP_020273004.1| clathrin interactor EPSIN 2 [Asparagus officinalis] Length = 836 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -1 Query: 348 NRDNGGRVDEPSQDDRRLERKLSGQSPRPSIEAAVKDAHEHVQDGR 211 +R++GGR DEPSQ++ RLERKLS QSP PS EAA KD +HVQD R Sbjct: 293 SRNSGGRGDEPSQEESRLERKLSEQSPPPSYEAATKDTRDHVQDER 338 >ref|XP_020265729.1| transcription initiation factor TFIID subunit 5 [Asparagus officinalis] gb|ONK70437.1| uncharacterized protein A4U43_C05F33720 [Asparagus officinalis] Length = 653 Score = 60.1 bits (144), Expect = 9e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 213 RSKNGAARYHDGYSKLRSWAYSSLDLYK 130 RSKNGAARYHDGY+KLRSWAY SLDLYK Sbjct: 43 RSKNGAARYHDGYNKLRSWAYGSLDLYK 70