BLASTX nr result
ID: Ophiopogon25_contig00010374
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00010374 (1887 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI07066.1| ATPase, F1 complex, beta subunit [Cynara carduncu... 70 6e-11 gb|ACZ72942.1| F1 ATPase beta subunit, partial [Corchorus capsul... 70 1e-10 gb|KMS98665.1| hypothetical protein BVRB_3g069750 [Beta vulgaris... 70 2e-10 gb|PHT34495.1| ATP synthase subunit beta, chloroplastic [Capsicu... 70 2e-10 gb|OMP13146.1| hypothetical protein COLO4_02195 [Corchorus olito... 70 2e-10 gb|AAT57700.1| ATP synthase beta chain, partial (chloroplast) [P... 70 2e-10 gb|EYU36961.1| hypothetical protein MIMGU_mgv1a026126mg, partial... 70 3e-10 gb|PKA46425.1| ATP synthase subunit beta, chloroplastic [Apostas... 69 3e-10 gb|AFS35559.1| ATP synthase CF1 beta subunit', partial (plastid)... 70 3e-10 gb|AGH25542.1| ATP synthase beta subunit, partial (chloroplast) ... 70 3e-10 emb|CAB94299.1| ATP synthase beta subunit, partial (chloroplast)... 70 5e-10 gb|AAM52119.1| ATP synthase beta subunit, partial (chloroplast) ... 70 6e-10 gb|PHT58583.1| ATP synthase subunit beta, chloroplastic [Capsicu... 69 8e-10 gb|AAT57691.1| ATP synthase beta chain, partial (chloroplast) [I... 68 8e-10 gb|ALO75645.1| ATP synthase beta subunit, partial (plastid) [Pho... 70 8e-10 gb|AKR17196.1| ATP synthase beta subunit, partial (chloroplast) ... 70 9e-10 gb|AEX31407.1| ATP synthase beta subunit, partial (plastid) [Tri... 69 9e-10 gb|AEX31437.1| ATP synthase beta subunit, partial (plastid) [Tri... 69 1e-09 gb|AEX31406.1| ATP synthase beta subunit, partial (plastid) [Tri... 69 1e-09 gb|AAT57687.1| ATP synthase beta chain, partial (chloroplast) [H... 68 1e-09 >gb|KVI07066.1| ATPase, F1 complex, beta subunit [Cynara cardunculus var. scolymus] Length = 98 Score = 69.7 bits (169), Expect = 6e-11 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 G RMRVGLTAL MAKYF DVNEQD+ LFIDNI RFVQ RSE S Sbjct: 31 GTRMRVGLTALTMAKYFRDVNEQDILLFIDNIFRFVQARSEES 73 >gb|ACZ72942.1| F1 ATPase beta subunit, partial [Corchorus capsularis] Length = 118 Score = 69.7 bits (169), Expect = 1e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 3 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 45 >gb|KMS98665.1| hypothetical protein BVRB_3g069750 [Beta vulgaris subsp. vulgaris] Length = 136 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 62 GARMRVGLTALTMAEYFKDVNEQDVLLFIDNIFRFVQAGSEVS 104 >gb|PHT34495.1| ATP synthase subunit beta, chloroplastic [Capsicum baccatum] Length = 137 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 6 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 48 >gb|OMP13146.1| hypothetical protein COLO4_02195 [Corchorus olitorius] Length = 147 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 24 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 66 >gb|AAT57700.1| ATP synthase beta chain, partial (chloroplast) [Preissia quadrata] Length = 147 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 84 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 126 >gb|EYU36961.1| hypothetical protein MIMGU_mgv1a026126mg, partial [Erythranthe guttata] Length = 151 Score = 69.7 bits (169), Expect = 3e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 19 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 61 >gb|PKA46425.1| ATP synthase subunit beta, chloroplastic [Apostasia shenzhenica] Length = 118 Score = 68.6 bits (166), Expect = 3e-10 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVSVS 1753 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SE+ ++ Sbjct: 62 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEIIIA 106 >gb|AFS35559.1| ATP synthase CF1 beta subunit', partial (plastid) [Fragaria pentaphylla] Length = 159 Score = 69.7 bits (169), Expect = 3e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 17 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 59 >gb|AGH25542.1| ATP synthase beta subunit, partial (chloroplast) [Monarda citriodora] Length = 160 Score = 69.7 bits (169), Expect = 3e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 21 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 63 >emb|CAB94299.1| ATP synthase beta subunit, partial (chloroplast) [Gnetum gnemon] Length = 186 Score = 69.7 bits (169), Expect = 5e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 39 GARMRVGLTALAMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 81 >gb|AAM52119.1| ATP synthase beta subunit, partial (chloroplast) [Paralepistemon shirensis] Length = 194 Score = 69.7 bits (169), Expect = 6e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 37 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 79 >gb|PHT58583.1| ATP synthase subunit beta, chloroplastic [Capsicum baccatum] Length = 190 Score = 69.3 bits (168), Expect = 8e-10 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SE+S Sbjct: 6 GARMRVGLTALTMAEYFQDVNEQDVLLFIDNIIRFVQEGSEIS 48 >gb|AAT57691.1| ATP synthase beta chain, partial (chloroplast) [Isotachis lyallii] Length = 136 Score = 67.8 bits (164), Expect = 8e-10 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF D+N+QDV LFIDNI RFVQ SEVS Sbjct: 84 GARMRVGLTALTMAEYFRDINKQDVLLFIDNIFRFVQAGSEVS 126 >gb|ALO75645.1| ATP synthase beta subunit, partial (plastid) [Phoenix dactylifera] Length = 207 Score = 69.7 bits (169), Expect = 8e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 161 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 203 >gb|AKR17196.1| ATP synthase beta subunit, partial (chloroplast) [Dioscorea pohlii] Length = 211 Score = 69.7 bits (169), Expect = 9e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVNEQDV LFIDNI RFVQ SEVS Sbjct: 61 GARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 103 >gb|AEX31407.1| ATP synthase beta subunit, partial (plastid) [Trithuria cowieana] Length = 166 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVN+QDV LFIDNI RFVQ SEVS Sbjct: 15 GARMRVGLTALTMAEYFRDVNQQDVLLFIDNIFRFVQAGSEVS 57 >gb|AEX31437.1| ATP synthase beta subunit, partial (plastid) [Trithuria submersa] Length = 171 Score = 68.6 bits (166), Expect = 1e-09 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVN+QDV LFIDNI RFVQ SEVS Sbjct: 20 GARMRVGLTALTMAEYFRDVNQQDVLLFIDNIFRFVQAGSEVS 62 >gb|AEX31406.1| ATP synthase beta subunit, partial (plastid) [Trithuria cowieana] Length = 172 Score = 68.6 bits (166), Expect = 1e-09 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF DVN+QDV LFIDNI RFVQ SEVS Sbjct: 21 GARMRVGLTALTMAEYFRDVNQQDVLLFIDNIFRFVQAGSEVS 63 >gb|AAT57687.1| ATP synthase beta chain, partial (chloroplast) [Haplomitrium blumei] Length = 147 Score = 67.8 bits (164), Expect = 1e-09 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -1 Query: 1887 GARMRVGLTALIMAKYF*DVNEQDVFLFIDNICRFVQTRSEVS 1759 GARMRVGLTAL MA+YF D+N+QDV LFIDNI RFVQ SEVS Sbjct: 84 GARMRVGLTALTMAEYFRDINKQDVLLFIDNIFRFVQAGSEVS 126