BLASTX nr result
ID: Ophiopogon25_contig00010299
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00010299 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU77037.1| hypothetical protein MA16_Dca001643 [Dendrobium c... 49 9e-07 gb|PKU61515.1| hypothetical protein MA16_Dca028763 [Dendrobium c... 52 4e-06 >gb|PKU77037.1| hypothetical protein MA16_Dca001643 [Dendrobium catenatum] Length = 193 Score = 48.5 bits (114), Expect(2) = 9e-07 Identities = 32/110 (29%), Positives = 58/110 (52%), Gaps = 25/110 (22%) Frame = +2 Query: 95 MQQQNKSSNANYKVRFDFCQKVNMFKIEDYV-------------ISCMH*SRTLRDVLN* 235 ++++ + +N NYK+ D ++ FK+ D+V + +H +R++R Sbjct: 25 IKKKIEQNNTNYKIHADKKKRFKEFKVGDFVMVRIRPERFPSGSVKKLH-ARSVRPFK-- 81 Query: 236 **CIYSEL------------FGVSPIFNIEDLVAYKGLDFNPSNPLLDEP 349 I S++ F ++P FNIED+VA++G +FNP+NPL +EP Sbjct: 82 ---IISKVNNNAYVLELLEGFNMNPTFNIEDIVAFEGPNFNPNNPLYNEP 128 Score = 32.0 bits (71), Expect(2) = 9e-07 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 42 TSEPTFAFA*HIHDLHMECSNRINQ 116 TSE FAF+ H+H+LH E +I Q Sbjct: 7 TSESAFAFSSHLHELHNEIKKKIEQ 31 >gb|PKU61515.1| hypothetical protein MA16_Dca028763 [Dendrobium catenatum] Length = 311 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 19/102 (18%) Frame = +2 Query: 101 QQNKSSNANYKVRFDFCQKVNMFKIEDYVISCMH*SR------------------TLRDV 226 Q + SN +YK+ D ++ FK+ D+V+ + R LR V Sbjct: 187 QNIEKSNKDYKLYADLKRRFKTFKVGDFVMVRIRPERFPQGTVKKLHAKSAGPFKILRKV 246 Query: 227 LN***CI-YSELFGVSPIFNIEDLVAYKGLDFNPSNPLLDEP 349 + + E F ++P FNIEDLVAY+G DFNP NP L +P Sbjct: 247 NDNAYVVDLPEDFNINPTFNIEDLVAYEGPDFNPPNPFLQQP 288 Score = 26.6 bits (57), Expect(2) = 4e-06 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 45 SEPTFAFA*HIHDLHMECSNRINQ 116 SE AFA H+H+LH E + I + Sbjct: 168 SESASAFASHLHELHKEIAQNIEK 191