BLASTX nr result
ID: Ophiopogon25_contig00010022
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00010022 (526 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010934329.1| PREDICTED: small nuclear ribonucleoprotein S... 114 9e-30 ref|XP_008791570.1| PREDICTED: small nuclear ribonucleoprotein S... 114 9e-30 ref|XP_008785258.1| PREDICTED: small nuclear ribonucleoprotein S... 114 9e-30 ref|XP_019709387.1| PREDICTED: small nuclear ribonucleoprotein S... 114 1e-29 ref|XP_010931131.1| PREDICTED: small nuclear ribonucleoprotein S... 113 3e-29 ref|XP_008667190.1| small nuclear ribonucleoprotein family prote... 112 3e-29 ref|XP_020111585.1| small nuclear ribonucleoprotein Sm D2-like [... 112 4e-29 gb|KYP58202.1| putative small nuclear ribonucleoprotein Sm D2 [C... 112 5e-29 ref|XP_021319836.1| small nuclear ribonucleoprotein Sm D2 isofor... 112 5e-29 ref|XP_014661010.1| small nuclear ribonucleoprotein Sm D2 isofor... 112 5e-29 gb|KHN13162.1| Putative small nuclear ribonucleoprotein Sm D2 [G... 112 5e-29 ref|XP_008661397.1| small nuclear ribonucleoprotein family prote... 112 5e-29 ref|NP_001131740.1| Small nuclear ribonucleoprotein family prote... 112 5e-29 ref|NP_001132149.1| Small nuclear ribonucleoprotein family prote... 112 5e-29 ref|XP_004976243.1| small nuclear ribonucleoprotein Sm D2 isofor... 112 5e-29 ref|XP_002448196.1| small nuclear ribonucleoprotein Sm D2 isofor... 112 5e-29 ref|XP_020227777.1| small nuclear ribonucleoprotein Sm D2-like [... 112 6e-29 ref|XP_006588396.1| PREDICTED: uncharacterized protein LOC100500... 112 6e-29 ref|NP_001241022.1| uncharacterized protein LOC100793233 [Glycin... 112 6e-29 ref|XP_018858297.1| PREDICTED: small nuclear ribonucleoprotein S... 112 6e-29 >ref|XP_010934329.1| PREDICTED: small nuclear ribonucleoprotein Sm D2 isoform X2 [Elaeis guineensis] ref|XP_010934330.1| PREDICTED: small nuclear ribonucleoprotein Sm D2 isoform X2 [Elaeis guineensis] ref|XP_019709389.1| PREDICTED: small nuclear ribonucleoprotein Sm D2 isoform X2 [Elaeis guineensis] Length = 105 Score = 114 bits (285), Expect = 9e-30 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 7 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 61 >ref|XP_008791570.1| PREDICTED: small nuclear ribonucleoprotein Sm D2-like [Phoenix dactylifera] ref|XP_008791571.1| PREDICTED: small nuclear ribonucleoprotein Sm D2-like [Phoenix dactylifera] ref|XP_010920461.1| PREDICTED: small nuclear ribonucleoprotein Sm D2 [Elaeis guineensis] Length = 105 Score = 114 bits (285), Expect = 9e-30 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 7 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 61 >ref|XP_008785258.1| PREDICTED: small nuclear ribonucleoprotein Sm D2-like [Phoenix dactylifera] Length = 105 Score = 114 bits (285), Expect = 9e-30 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 7 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 61 >ref|XP_019709387.1| PREDICTED: small nuclear ribonucleoprotein Sm D2 isoform X1 [Elaeis guineensis] ref|XP_019709388.1| PREDICTED: small nuclear ribonucleoprotein Sm D2 isoform X1 [Elaeis guineensis] Length = 113 Score = 114 bits (285), Expect = 1e-29 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 15 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 69 >ref|XP_010931131.1| PREDICTED: small nuclear ribonucleoprotein Sm D2 [Elaeis guineensis] Length = 106 Score = 113 bits (282), Expect = 3e-29 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 +GKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 8 SGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 62 >ref|XP_008667190.1| small nuclear ribonucleoprotein family protein isoform X1 [Zea mays] gb|ACR34525.1| unknown [Zea mays] Length = 85 Score = 112 bits (280), Expect = 3e-29 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEF+TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 7 AGKKEEEEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 61 >ref|XP_020111585.1| small nuclear ribonucleoprotein Sm D2-like [Ananas comosus] gb|OAY63965.1| putative small nuclear ribonucleoprotein Sm D2 [Ananas comosus] Length = 106 Score = 112 bits (281), Expect = 4e-29 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +3 Query: 363 GKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 GKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 9 GKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 62 >gb|KYP58202.1| putative small nuclear ribonucleoprotein Sm D2 [Cajanus cajan] Length = 104 Score = 112 bits (280), Expect = 5e-29 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGK EEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 6 AGKNEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 60 >ref|XP_021319836.1| small nuclear ribonucleoprotein Sm D2 isoform X2 [Sorghum bicolor] ref|XP_021319837.1| small nuclear ribonucleoprotein Sm D2 isoform X2 [Sorghum bicolor] gb|KXG26726.1| hypothetical protein SORBI_3006G149200 [Sorghum bicolor] gb|KXG26728.1| hypothetical protein SORBI_3006G149200 [Sorghum bicolor] Length = 104 Score = 112 bits (280), Expect = 5e-29 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEF+TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 6 AGKKEEEEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 60 >ref|XP_014661010.1| small nuclear ribonucleoprotein Sm D2 isoform X2 [Setaria italica] gb|PAN39116.1| hypothetical protein PAHAL_G01094 [Panicum hallii] gb|PAN39118.1| hypothetical protein PAHAL_G01094 [Panicum hallii] Length = 104 Score = 112 bits (280), Expect = 5e-29 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEF+TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 6 AGKKEEEEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 60 >gb|KHN13162.1| Putative small nuclear ribonucleoprotein Sm D2 [Glycine soja] Length = 104 Score = 112 bits (280), Expect = 5e-29 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGK EEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 6 AGKNEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 60 >ref|XP_008661397.1| small nuclear ribonucleoprotein family protein isoform X1 [Zea mays] gb|AQK44908.1| Small nuclear ribonucleoprotein family protein [Zea mays] Length = 104 Score = 112 bits (280), Expect = 5e-29 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEF+TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 6 AGKKEEEEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 60 >ref|NP_001131740.1| Small nuclear ribonucleoprotein family protein [Zea mays] gb|ACF80282.1| unknown [Zea mays] gb|ACG36505.1| small nuclear ribonucleoprotein Sm D2 [Zea mays] gb|AQK44909.1| Small nuclear ribonucleoprotein family protein [Zea mays] gb|AQK44910.1| Small nuclear ribonucleoprotein family protein [Zea mays] Length = 105 Score = 112 bits (280), Expect = 5e-29 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEF+TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 7 AGKKEEEEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 61 >ref|NP_001132149.1| Small nuclear ribonucleoprotein family protein [Zea mays] gb|ACF80872.1| unknown [Zea mays] gb|ONM15876.1| Small nuclear ribonucleoprotein family protein [Zea mays] gb|ONM15877.1| Small nuclear ribonucleoprotein family protein [Zea mays] gb|ONM15878.1| Small nuclear ribonucleoprotein family protein [Zea mays] gb|ONM15879.1| Small nuclear ribonucleoprotein family protein [Zea mays] Length = 105 Score = 112 bits (280), Expect = 5e-29 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEF+TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 7 AGKKEEEEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 61 >ref|XP_004976243.1| small nuclear ribonucleoprotein Sm D2 isoform X1 [Setaria italica] gb|KQK98118.1| hypothetical protein SETIT_011415mg [Setaria italica] gb|PAN39117.1| hypothetical protein PAHAL_G01094 [Panicum hallii] gb|PAN39119.1| hypothetical protein PAHAL_G01094 [Panicum hallii] Length = 105 Score = 112 bits (280), Expect = 5e-29 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEF+TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 7 AGKKEEEEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 61 >ref|XP_002448196.1| small nuclear ribonucleoprotein Sm D2 isoform X1 [Sorghum bicolor] ref|XP_021319835.1| small nuclear ribonucleoprotein Sm D2 isoform X1 [Sorghum bicolor] gb|EES12524.1| hypothetical protein SORBI_3006G149200 [Sorghum bicolor] gb|KXG26727.1| hypothetical protein SORBI_3006G149200 [Sorghum bicolor] Length = 105 Score = 112 bits (280), Expect = 5e-29 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGKKEEEEF+TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 7 AGKKEEEEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 61 >ref|XP_020227777.1| small nuclear ribonucleoprotein Sm D2-like [Cajanus cajan] Length = 108 Score = 112 bits (280), Expect = 6e-29 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGK EEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 10 AGKNEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 64 >ref|XP_006588396.1| PREDICTED: uncharacterized protein LOC100500203 isoform X1 [Glycine max] gb|KHN01067.1| Putative small nuclear ribonucleoprotein Sm D2 [Glycine soja] gb|KRH34474.1| hypothetical protein GLYMA_10G186300 [Glycine max] Length = 108 Score = 112 bits (280), Expect = 6e-29 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGK EEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 10 AGKNEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 64 >ref|NP_001241022.1| uncharacterized protein LOC100793233 [Glycine max] gb|ACU17317.1| unknown [Glycine max] Length = 108 Score = 112 bits (280), Expect = 6e-29 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGK EEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 10 AGKNEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 64 >ref|XP_018858297.1| PREDICTED: small nuclear ribonucleoprotein Sm D2 [Juglans regia] Length = 109 Score = 112 bits (280), Expect = 6e-29 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = +3 Query: 360 AGKKEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 524 AGK EEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV Sbjct: 11 AGKNEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENV 65