BLASTX nr result
ID: Ophiopogon25_contig00009811
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00009811 (813 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275859.1| protein BRANCHLESS TRICHOME-like [Asparagus ... 64 1e-08 >ref|XP_020275859.1| protein BRANCHLESS TRICHOME-like [Asparagus officinalis] gb|ONK63134.1| uncharacterized protein A4U43_C07F11760 [Asparagus officinalis] Length = 196 Score = 64.3 bits (155), Expect = 1e-08 Identities = 35/50 (70%), Positives = 36/50 (72%) Frame = -3 Query: 739 SRSSYHTRDLSSFARPMXXXXXXXXXXXXLAEIKELRAELEFGRRMRRKV 590 SRSSYHTRDL SF+RPM LAEIKELRAELEF RRMRRKV Sbjct: 66 SRSSYHTRDLGSFSRPMNRDVNLSDLDNALAEIKELRAELEFERRMRRKV 115