BLASTX nr result
ID: Ophiopogon25_contig00009737
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00009737 (1130 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ATP62971.1| hypothetical protein 2_1028_01, partial [Pinus pi... 76 3e-13 gb|ATP67713.1| hypothetical protein 2_1028_01, partial [Pinus sy... 74 1e-12 gb|ONK75369.1| uncharacterized protein A4U43_C03F16110 [Asparagu... 79 1e-12 ref|XP_023871783.1| uncharacterized protein LOC111984381 [Quercu... 79 2e-12 ref|XP_020258559.1| LOW QUALITY PROTEIN: uncharacterized protein... 79 2e-12 ref|XP_020541403.1| uncharacterized protein LOC105650315 isoform... 78 3e-12 gb|KJB11114.1| hypothetical protein B456_001G241400 [Gossypium r... 77 4e-12 ref|XP_010934792.1| PREDICTED: uncharacterized protein LOC105054... 78 4e-12 ref|XP_012092584.1| uncharacterized protein LOC105650315 isoform... 78 4e-12 gb|PKA52538.1| hypothetical protein AXF42_Ash001518 [Apostasia s... 78 5e-12 ref|XP_020240879.1| uncharacterized protein LOC109819535 [Aspara... 78 5e-12 gb|OAY74912.1| hypothetical protein ACMD2_26040, partial [Ananas... 77 7e-12 gb|ACI87790.1| putative carboxyl-terminal proteinase, partial [C... 72 9e-12 gb|OAY75950.1| hypothetical protein ACMD2_23534 [Ananas comosus] 77 1e-11 ref|XP_020092569.1| uncharacterized protein LOC109713044 [Ananas... 77 1e-11 gb|PON86365.1| hypothetical protein TorRG33x02_178170 [Trema ori... 76 2e-11 gb|PON68639.1| hypothetical protein PanWU01x14_094480 [Parasponi... 76 2e-11 gb|PAN14576.1| hypothetical protein PAHAL_B04421 [Panicum hallii] 76 2e-11 ref|NP_001152099.1| carboxyl-terminal peptidase precursor [Zea m... 76 2e-11 gb|ACF87904.1| unknown [Zea mays] >gi|223943399|gb|ACN25783.1| u... 76 2e-11 >gb|ATP62971.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62972.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62973.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62974.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62975.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62976.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62977.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62978.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62979.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62980.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62981.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62982.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62983.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62984.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62985.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62986.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62987.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62988.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62989.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62990.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62991.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62992.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62993.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62994.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62995.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62996.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62997.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62998.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP62999.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP63000.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP63001.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP63002.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP63003.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP63004.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP63005.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP67721.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP67722.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP67723.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP67724.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP67725.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP67726.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP67727.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP67728.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] gb|ATP67729.1| hypothetical protein 2_1028_01, partial [Pinus pinaster] Length = 111 Score = 75.9 bits (185), Expect = 3e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQ+N+DIAMGA+IYP+S YGGSQYDI ILVWK Sbjct: 29 NLLCSGFIQVNSDIAMGATIYPVSNYGGSQYDISILVWK 67 >gb|ATP67713.1| hypothetical protein 2_1028_01, partial [Pinus sylvestris] gb|ATP67714.1| hypothetical protein 2_1028_01, partial [Pinus sylvestris] gb|ATP67715.1| hypothetical protein 2_1028_01, partial [Pinus sylvestris] gb|ATP67716.1| hypothetical protein 2_1028_01, partial [Pinus sylvestris] gb|ATP67717.1| hypothetical protein 2_1028_01, partial [Pinus sylvestris] gb|ATP67718.1| hypothetical protein 2_1028_01, partial [Pinus sylvestris] gb|ATP67719.1| hypothetical protein 2_1028_01, partial [Pinus sylvestris] gb|ATP67720.1| hypothetical protein 2_1028_01, partial [Pinus sylvestris] Length = 111 Score = 74.3 bits (181), Expect = 1e-12 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQ+N+DIAMGA+I+P+S YGGSQYDI ILVWK Sbjct: 29 NLLCSGFIQVNSDIAMGATIFPVSNYGGSQYDISILVWK 67 >gb|ONK75369.1| uncharacterized protein A4U43_C03F16110 [Asparagus officinalis] Length = 331 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQINN+IAMGASI+PISGYGGSQYDI ILVWK Sbjct: 168 NLLCSGFIQINNEIAMGASIFPISGYGGSQYDISILVWK 206 >ref|XP_023871783.1| uncharacterized protein LOC111984381 [Quercus suber] gb|POE86709.1| hypothetical protein CFP56_46920 [Quercus suber] Length = 427 Score = 79.3 bits (194), Expect = 2e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQINN IAMGASIYP+SGYGGSQYDI ILVWK Sbjct: 263 NLLCSGFIQINNQIAMGASIYPVSGYGGSQYDISILVWK 301 >ref|XP_020258559.1| LOW QUALITY PROTEIN: uncharacterized protein LOC109834963 [Asparagus officinalis] Length = 435 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQINN+IAMGASI+PISGYGGSQYDI ILVWK Sbjct: 272 NLLCSGFIQINNEIAMGASIFPISGYGGSQYDISILVWK 310 >ref|XP_020541403.1| uncharacterized protein LOC105650315 isoform X2 [Jatropha curcas] Length = 390 Score = 78.2 bits (191), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGF+QINN IAMGASIYP+SGYGGSQYDI +LVWK Sbjct: 227 NLLCSGFVQINNQIAMGASIYPVSGYGGSQYDISLLVWK 265 >gb|KJB11114.1| hypothetical protein B456_001G241400 [Gossypium raimondii] Length = 320 Score = 77.4 bits (189), Expect = 4e-12 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWKVRTKTTCNVHSIFFFKSQ 959 NLLCSGFIQINN+IAMGASIYP+S Y SQYDI +LVWKV +K + + F K Q Sbjct: 259 NLLCSGFIQINNEIAMGASIYPVSSYHDSQYDISLLVWKVMSKKLFIISKLPFHKHQ 315 >ref|XP_010934792.1| PREDICTED: uncharacterized protein LOC105054863 [Elaeis guineensis] Length = 413 Score = 78.2 bits (191), Expect = 4e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQIN +IAMGASIYPISGYGGSQYDI ILVWK Sbjct: 250 NLLCSGFIQINREIAMGASIYPISGYGGSQYDISILVWK 288 >ref|XP_012092584.1| uncharacterized protein LOC105650315 isoform X1 [Jatropha curcas] gb|KDP20368.1| hypothetical protein JCGZ_05251 [Jatropha curcas] Length = 419 Score = 78.2 bits (191), Expect = 4e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGF+QINN IAMGASIYP+SGYGGSQYDI +LVWK Sbjct: 256 NLLCSGFVQINNQIAMGASIYPVSGYGGSQYDISLLVWK 294 >gb|PKA52538.1| hypothetical protein AXF42_Ash001518 [Apostasia shenzhenica] Length = 409 Score = 77.8 bits (190), Expect = 5e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQ+NN IAMGASIYPISGYG SQYDI+ILVWK Sbjct: 246 NLLCSGFIQLNNQIAMGASIYPISGYGSSQYDIKILVWK 284 >ref|XP_020240879.1| uncharacterized protein LOC109819535 [Asparagus officinalis] gb|ONK59673.1| uncharacterized protein A4U43_C08F9130 [Asparagus officinalis] Length = 414 Score = 77.8 bits (190), Expect = 5e-12 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQIN+++AMGASI+PISGYGGSQYDI+ILVWK Sbjct: 251 NLLCSGFIQINSEVAMGASIFPISGYGGSQYDIKILVWK 289 >gb|OAY74912.1| hypothetical protein ACMD2_26040, partial [Ananas comosus] Length = 318 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQIN++IAMGASIYPISGYGG QYDI ILVWK Sbjct: 150 NLLCSGFIQINSEIAMGASIYPISGYGGPQYDISILVWK 188 >gb|ACI87790.1| putative carboxyl-terminal proteinase, partial [Cupressus sempervirens] Length = 107 Score = 71.6 bits (174), Expect = 9e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQI++DIAMGASI P+S YGGSQYDI IL+WK Sbjct: 10 NLLCSGFIQISSDIAMGASISPVSNYGGSQYDISILIWK 48 >gb|OAY75950.1| hypothetical protein ACMD2_23534 [Ananas comosus] Length = 396 Score = 76.6 bits (187), Expect = 1e-11 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQIN++IAMGASIYPISGYGG QYDI ILVWK Sbjct: 233 NLLCSGFIQINSEIAMGASIYPISGYGGPQYDISILVWK 271 >ref|XP_020092569.1| uncharacterized protein LOC109713044 [Ananas comosus] Length = 414 Score = 76.6 bits (187), Expect = 1e-11 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQIN++IAMGASIYPISGYGG QYDI ILVWK Sbjct: 251 NLLCSGFIQINSEIAMGASIYPISGYGGPQYDISILVWK 289 >gb|PON86365.1| hypothetical protein TorRG33x02_178170 [Trema orientalis] Length = 413 Score = 76.3 bits (186), Expect = 2e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQINN+IAMGASIYP+SGY GSQYDI IL+WK Sbjct: 250 NLLCSGFIQINNEIAMGASIYPVSGYQGSQYDINILLWK 288 >gb|PON68639.1| hypothetical protein PanWU01x14_094480 [Parasponia andersonii] Length = 414 Score = 76.3 bits (186), Expect = 2e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQINN+IAMGASIYP+SGY GSQYDI IL+WK Sbjct: 251 NLLCSGFIQINNEIAMGASIYPVSGYQGSQYDINILLWK 289 >gb|PAN14576.1| hypothetical protein PAHAL_B04421 [Panicum hallii] Length = 424 Score = 76.3 bits (186), Expect = 2e-11 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQINN IAMGASI+PIS YGGSQYDI ILVWK Sbjct: 261 NLLCSGFIQINNQIAMGASIFPISNYGGSQYDINILVWK 299 >ref|NP_001152099.1| carboxyl-terminal peptidase precursor [Zea mays] gb|ACG45769.1| carboxyl-terminal peptidase [Zea mays] Length = 428 Score = 76.3 bits (186), Expect = 2e-11 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQINN IAMGASI+PIS YGGSQYDI ILVWK Sbjct: 265 NLLCSGFIQINNQIAMGASIFPISNYGGSQYDINILVWK 303 >gb|ACF87904.1| unknown [Zea mays] gb|ACN25783.1| unknown [Zea mays] gb|ACN33237.1| unknown [Zea mays] gb|ACN33598.1| unknown [Zea mays] gb|ONM58950.1| NEP-interacting protein 1 [Zea mays] Length = 428 Score = 76.3 bits (186), Expect = 2e-11 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -2 Query: 1129 NLLCSGFIQINNDIAMGASIYPISGYGGSQYDIRILVWK 1013 NLLCSGFIQINN IAMGASI+PIS YGGSQYDI ILVWK Sbjct: 265 NLLCSGFIQINNQIAMGASIFPISNYGGSQYDINILVWK 303