BLASTX nr result
ID: Ophiopogon25_contig00008969
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00008969 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253089.1| mitogen-activated protein kinase kinase kina... 73 3e-12 gb|ONK77419.1| uncharacterized protein A4U43_C02F6330 [Asparagus... 73 3e-12 >ref|XP_020253089.1| mitogen-activated protein kinase kinase kinase 3-like [Asparagus officinalis] Length = 492 Score = 73.2 bits (178), Expect = 3e-12 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +1 Query: 1 YSAGAVNYGPNNFSLYHTRACNNLDQWPDIPQLKAQTPPQLSPYGSPRRQ 150 +SAGA+NYGP+N+SLYHTRACNN DQ P++PQ K+QT Y SPRR+ Sbjct: 448 FSAGAINYGPSNYSLYHTRACNNFDQLPELPQFKSQT-----TYSSPRRR 492 >gb|ONK77419.1| uncharacterized protein A4U43_C02F6330 [Asparagus officinalis] Length = 615 Score = 73.2 bits (178), Expect = 3e-12 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +1 Query: 1 YSAGAVNYGPNNFSLYHTRACNNLDQWPDIPQLKAQTPPQLSPYGSPRRQ 150 +SAGA+NYGP+N+SLYHTRACNN DQ P++PQ K+QT Y SPRR+ Sbjct: 571 FSAGAINYGPSNYSLYHTRACNNFDQLPELPQFKSQT-----TYSSPRRR 615