BLASTX nr result
ID: Ophiopogon25_contig00008317
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00008317 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240849.1| plant cysteine oxidase 2-like [Asparagus off... 64 3e-09 ref|XP_020097924.1| plant cysteine oxidase 2-like [Ananas comosus] 58 3e-07 gb|OAY79900.1| Plant cysteine oxidase 2 [Ananas comosus] 58 3e-07 ref|XP_018685476.1| PREDICTED: plant cysteine oxidase 2-like iso... 55 4e-06 ref|XP_009415343.1| PREDICTED: plant cysteine oxidase 2-like iso... 55 4e-06 >ref|XP_020240849.1| plant cysteine oxidase 2-like [Asparagus officinalis] Length = 278 Score = 63.5 bits (153), Expect = 3e-09 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -3 Query: 360 EGEQYAWLEERERKPDELVVLGAKYKGPRIVEH 262 EGE YAWLEE+E+KPD+L+V+GAKYKGP+IV+H Sbjct: 246 EGEMYAWLEEKEKKPDDLIVVGAKYKGPKIVQH 278 >ref|XP_020097924.1| plant cysteine oxidase 2-like [Ananas comosus] Length = 276 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 360 EGEQYAWLEERERKPDELVVLGAKYKGPRIVEH 262 EGE YAWLEERER PD+++V+GAKY+GPRIVEH Sbjct: 245 EGEGYAWLEERER-PDDVLVVGAKYRGPRIVEH 276 >gb|OAY79900.1| Plant cysteine oxidase 2 [Ananas comosus] Length = 276 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 360 EGEQYAWLEERERKPDELVVLGAKYKGPRIVEH 262 EGE YAWLEERER PD+++V+GAKY+GPRIVEH Sbjct: 245 EGEGYAWLEERER-PDDVLVVGAKYRGPRIVEH 276 >ref|XP_018685476.1| PREDICTED: plant cysteine oxidase 2-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 245 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 354 EQYAWLEERERKPDELVVLGAKYKGPRIVEH 262 E YAWLEER +PDELVV GA+YKGPRIV+H Sbjct: 215 EYYAWLEERGSEPDELVVRGAEYKGPRIVDH 245 >ref|XP_009415343.1| PREDICTED: plant cysteine oxidase 2-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 280 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 354 EQYAWLEERERKPDELVVLGAKYKGPRIVEH 262 E YAWLEER +PDELVV GA+YKGPRIV+H Sbjct: 250 EYYAWLEERGSEPDELVVRGAEYKGPRIVDH 280