BLASTX nr result
ID: Ophiopogon25_contig00008160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00008160 (569 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK63985.1| uncharacterized protein A4U43_C07F20930 [Asparagu... 74 4e-13 >gb|ONK63985.1| uncharacterized protein A4U43_C07F20930 [Asparagus officinalis] Length = 173 Score = 73.9 bits (180), Expect = 4e-13 Identities = 37/84 (44%), Positives = 53/84 (63%) Frame = -2 Query: 565 PPPNVVCKCNCGDRLKMKISTTERNPFRRFGRCASGTCDRFAWLDTEEESSYAKSIINIL 386 PPP + CG ++MK S T R+P RRFG CA+ TC+ + WLD E SYA +NI Sbjct: 60 PPPYEIPNFFCGIPVQMKTSYTLRHPCRRFGICATNTCNCWTWLDHGEVPSYAHDSMNIF 119 Query: 385 IRKYGELASQCERLRTMEYEVDSG 314 IRK+ EL+ + E+LR+ + ++G Sbjct: 120 IRKFEELSIENEKLRSRIHNEENG 143