BLASTX nr result
ID: Ophiopogon25_contig00007972
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00007972 (491 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275308.1| microtubule-associated protein TORTIFOLIA1-l... 56 6e-06 >ref|XP_020275308.1| microtubule-associated protein TORTIFOLIA1-like [Asparagus officinalis] gb|ONK65487.1| uncharacterized protein A4U43_C07F37610 [Asparagus officinalis] Length = 720 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 377 VKPVRDSMREALQIWEKITGKGGDDVSENLKG 472 VKPVRDSM EALQ+W+KI+G+GGDD +EN KG Sbjct: 99 VKPVRDSMMEALQLWKKISGRGGDDTAENPKG 130