BLASTX nr result
ID: Ophiopogon25_contig00007933
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00007933 (638 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257799.1| lysM domain receptor-like kinase 4 [Asparagu... 58 3e-06 >ref|XP_020257799.1| lysM domain receptor-like kinase 4 [Asparagus officinalis] gb|ONK75974.1| uncharacterized protein A4U43_C03F22510 [Asparagus officinalis] Length = 640 Score = 58.2 bits (139), Expect = 3e-06 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 309 AQFSDIWQSLKVHKFQESQLATEHFSHKYRIEGSVYWGLFNGD 181 + SDI QSLKV+KF+E QLAT++FS +IEGSVY G+FNGD Sbjct: 340 SSISDIGQSLKVYKFEELQLATKNFSKDCKIEGSVYRGVFNGD 382