BLASTX nr result
ID: Ophiopogon25_contig00007884
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00007884 (346 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU65362.1| Beta-galactosidase [Dendrobium catenatum] 62 7e-09 ref|XP_008793242.1| PREDICTED: beta-galactosidase [Phoenix dacty... 62 7e-09 ref|XP_020681450.1| beta-galactosidase 2-like, partial [Dendrobi... 62 9e-09 gb|AEG76892.1| putative beta-galactosidase [Linum usitatissimum]... 62 9e-09 gb|ONM40728.1| Beta-galactosidase 1 [Zea mays] 60 1e-08 ref|XP_020269630.1| beta-galactosidase 2-like isoform X2 [Aspara... 62 1e-08 ref|XP_020269629.1| beta-galactosidase-like isoform X1 [Asparagu... 62 1e-08 gb|ONK66471.1| uncharacterized protein A4U43_C06F8450 [Asparagus... 62 1e-08 ref|XP_006475426.1| PREDICTED: beta-galactosidase-like [Citrus s... 61 2e-08 dbj|GAY56147.1| hypothetical protein CUMW_169640 [Citrus unshiu] 61 2e-08 gb|KMZ68207.1| Beta-galactosidase, family GH35 [Zostera marina] 61 2e-08 gb|ACC78255.1| beta-galactosidase [Carica papaya] 61 2e-08 gb|AAC77377.1| beta-galactosidase precursor [Carica papaya] 61 2e-08 ref|XP_016453890.1| PREDICTED: beta-galactosidase-like [Nicotian... 61 2e-08 ref|XP_018684687.1| PREDICTED: beta-galactosidase-like isoform X... 61 2e-08 ref|XP_021893287.1| beta-galactosidase-like [Carica papaya] 61 2e-08 gb|OVA08439.1| D-galactoside/L-rhamnose binding SUEL lectin doma... 61 2e-08 ref|XP_002514109.1| PREDICTED: beta-galactosidase [Ricinus commu... 61 2e-08 ref|XP_009146456.2| PREDICTED: beta-galactosidase 1 [Brassica rapa] 61 2e-08 ref|XP_013749828.1| beta-galactosidase 1 [Brassica napus] 61 2e-08 >gb|PKU65362.1| Beta-galactosidase [Dendrobium catenatum] Length = 306 Score = 62.0 bits (149), Expect = 7e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRV 257 RSWL PT+NL+VVFEEWGGDPTGISLVKR+ Sbjct: 269 RSWLNPTKNLIVVFEEWGGDPTGISLVKRI 298 >ref|XP_008793242.1| PREDICTED: beta-galactosidase [Phoenix dactylifera] Length = 840 Score = 62.4 bits (150), Expect = 7e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVV 254 RSWL PT NLLVVFEEWGGDPTGIS+VKR+V Sbjct: 703 RSWLNPTGNLLVVFEEWGGDPTGISMVKRIV 733 >ref|XP_020681450.1| beta-galactosidase 2-like, partial [Dendrobium catenatum] Length = 410 Score = 62.0 bits (149), Expect = 9e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRV 257 RSWL PT+NL+VVFEEWGGDPTGISLVKR+ Sbjct: 373 RSWLNPTKNLIVVFEEWGGDPTGISLVKRI 402 >gb|AEG76892.1| putative beta-galactosidase [Linum usitatissimum] gb|AEG76893.1| putative beta-galactosidase [Linum usitatissimum] Length = 731 Score = 62.0 bits (149), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVV 254 RSWLKPT NLLVVFEEWGGDPTGIS+VKR + Sbjct: 698 RSWLKPTGNLLVVFEEWGGDPTGISMVKRTL 728 >gb|ONM40728.1| Beta-galactosidase 1 [Zea mays] Length = 196 Score = 60.5 bits (145), Expect = 1e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRV 257 RSWL PT NLLV+FEEWGGDPTGIS+VKR+ Sbjct: 59 RSWLNPTGNLLVIFEEWGGDPTGISMVKRI 88 >ref|XP_020269630.1| beta-galactosidase 2-like isoform X2 [Asparagus officinalis] Length = 393 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVVE 251 RSWL PT+NL+VVFEEWGGDP GISLVKRV E Sbjct: 362 RSWLNPTDNLIVVFEEWGGDPNGISLVKRVGE 393 >ref|XP_020269629.1| beta-galactosidase-like isoform X1 [Asparagus officinalis] Length = 453 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVVE 251 RSWL PT+NL+VVFEEWGGDP GISLVKRV E Sbjct: 422 RSWLNPTDNLIVVFEEWGGDPNGISLVKRVGE 453 >gb|ONK66471.1| uncharacterized protein A4U43_C06F8450 [Asparagus officinalis] Length = 530 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVVE 251 RSWL PT+NL+VVFEEWGGDP GISLVKRV E Sbjct: 499 RSWLNPTDNLIVVFEEWGGDPNGISLVKRVGE 530 >ref|XP_006475426.1| PREDICTED: beta-galactosidase-like [Citrus sinensis] ref|XP_006451463.2| beta-galactosidase [Citrus clementina] ref|XP_024034221.1| beta-galactosidase [Citrus clementina] Length = 730 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVV 254 RSWLKPT NLLVVFEEWGGDPTGISL++R + Sbjct: 700 RSWLKPTGNLLVVFEEWGGDPTGISLLRRTI 730 >dbj|GAY56147.1| hypothetical protein CUMW_169640 [Citrus unshiu] Length = 734 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVV 254 RSWLKPT NLLVVFEEWGGDPTGISL++R + Sbjct: 704 RSWLKPTGNLLVVFEEWGGDPTGISLLRRTI 734 >gb|KMZ68207.1| Beta-galactosidase, family GH35 [Zostera marina] Length = 840 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVV 254 RSWLKP N++VVFEEWGGDPTGISLVKR+V Sbjct: 702 RSWLKPVGNIVVVFEEWGGDPTGISLVKRIV 732 >gb|ACC78255.1| beta-galactosidase [Carica papaya] Length = 721 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVV 254 RSWL PT NLLVVFEEWGGDPT ISLVKRVV Sbjct: 691 RSWLNPTANLLVVFEEWGGDPTKISLVKRVV 721 >gb|AAC77377.1| beta-galactosidase precursor [Carica papaya] Length = 721 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVV 254 RSWL PT NLLVVFEEWGGDPT ISLVKRVV Sbjct: 691 RSWLNPTANLLVVFEEWGGDPTKISLVKRVV 721 >ref|XP_016453890.1| PREDICTED: beta-galactosidase-like [Nicotiana tabacum] Length = 725 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKR 260 RSWLKP+ NLLVVFEEWGGDPTGISLVKR Sbjct: 695 RSWLKPSGNLLVVFEEWGGDPTGISLVKR 723 >ref|XP_018684687.1| PREDICTED: beta-galactosidase-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 730 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRV 257 R+WL PT NLLVVFEEWGGDPTGISLVKRV Sbjct: 699 RAWLNPTGNLLVVFEEWGGDPTGISLVKRV 728 >ref|XP_021893287.1| beta-galactosidase-like [Carica papaya] Length = 788 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVV 254 RSWL PT NLLVVFEEWGGDPT ISLVKRVV Sbjct: 758 RSWLNPTANLLVVFEEWGGDPTKISLVKRVV 788 >gb|OVA08439.1| D-galactoside/L-rhamnose binding SUEL lectin domain [Macleaya cordata] Length = 823 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVVE 251 RSWLKPT NLLVVFEEWGGDP GISLV R +E Sbjct: 680 RSWLKPTGNLLVVFEEWGGDPNGISLVGRTIE 711 >ref|XP_002514109.1| PREDICTED: beta-galactosidase [Ricinus communis] gb|EEF48063.1| beta-galactosidase, putative [Ricinus communis] Length = 827 Score = 60.8 bits (146), Expect = 2e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVV 254 RSWLKPT NLLVVFEE GGDPTGISLVKRVV Sbjct: 690 RSWLKPTGNLLVVFEEMGGDPTGISLVKRVV 720 >ref|XP_009146456.2| PREDICTED: beta-galactosidase 1 [Brassica rapa] Length = 839 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVVE 251 RSWLKPT NLLVVFEEWGGDP GISLV+R V+ Sbjct: 696 RSWLKPTGNLLVVFEEWGGDPNGISLVRREVD 727 >ref|XP_013749828.1| beta-galactosidase 1 [Brassica napus] Length = 839 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 346 RSWLKPTENLLVVFEEWGGDPTGISLVKRVVE 251 RSWLKPT NLLVVFEEWGGDP GISLV+R V+ Sbjct: 696 RSWLKPTGNLLVVFEEWGGDPNGISLVRREVD 727