BLASTX nr result
ID: Ophiopogon25_contig00007694
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00007694 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275889.1| clp protease adapter protein ClpF, chloropla... 74 2e-12 gb|OVA11934.1| UVR domain [Macleaya cordata] 72 7e-12 ref|XP_015873017.1| PREDICTED: uncharacterized protein LOC107410... 65 6e-11 gb|PON40199.1| Hemimethylated DNA-binding domain containing prot... 69 1e-10 gb|PON79631.1| Hemimethylated DNA-binding domain containing prot... 69 1e-10 ref|XP_008339838.1| PREDICTED: uncharacterized protein LOC103402... 68 2e-10 ref|XP_021997272.1| clp protease adapter protein ClpF, chloropla... 67 3e-10 ref|XP_006848709.1| clp protease adapter protein ClpF, chloropla... 67 3e-10 dbj|GAV74537.1| Macro domain-containing protein/UVR domain-conta... 68 3e-10 ref|XP_021299790.1| clp protease adapter protein ClpF, chloropla... 66 8e-10 ref|XP_021299789.1| clp protease adapter protein ClpF, chloropla... 66 8e-10 ref|XP_010938850.1| PREDICTED: clp protease adapter protein ClpF... 66 1e-09 ref|XP_021807599.1| clp protease adapter protein ClpF, chloropla... 66 1e-09 ref|XP_010938843.1| PREDICTED: clp protease adapter protein ClpF... 66 1e-09 ref|XP_008221543.1| PREDICTED: uncharacterized protein LOC103321... 66 1e-09 ref|XP_023764592.1| clp protease adapter protein ClpF, chloropla... 65 1e-09 ref|XP_009388914.1| PREDICTED: uncharacterized protein LOC103975... 65 1e-09 ref|XP_023764591.1| clp protease adapter protein ClpF, chloropla... 65 2e-09 ref|XP_020091404.1| clp protease adapter protein ClpF, chloropla... 65 2e-09 ref|XP_020216477.1| clp protease adapter protein ClpF, chloropla... 65 2e-09 >ref|XP_020275889.1| clp protease adapter protein ClpF, chloroplastic [Asparagus officinalis] ref|XP_020275890.1| clp protease adapter protein ClpF, chloroplastic [Asparagus officinalis] gb|ONK64799.1| uncharacterized protein A4U43_C07F30070 [Asparagus officinalis] Length = 332 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGDDKN 117 FYG DSAGDFIPIKQLREKYNRPRHEV +D+NDE D KN Sbjct: 293 FYGEDSAGDFIPIKQLREKYNRPRHEVPMDMNDEDDGKN 331 >gb|OVA11934.1| UVR domain [Macleaya cordata] Length = 340 Score = 72.0 bits (175), Expect = 7e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGDDKN 117 FYG+DSAGDFIPIKQLREKYNRPR+EV +D DEGDDK+ Sbjct: 300 FYGIDSAGDFIPIKQLREKYNRPRYEVPVDSEDEGDDKD 338 >ref|XP_015873017.1| PREDICTED: uncharacterized protein LOC107410121 [Ziziphus jujuba] Length = 93 Score = 65.1 bits (157), Expect = 6e-11 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDE 102 FYGMD+AGDFIP+KQLREKYNRPRHE+ +D DE Sbjct: 60 FYGMDAAGDFIPVKQLREKYNRPRHEIPIDPEDE 93 >gb|PON40199.1| Hemimethylated DNA-binding domain containing protein [Trema orientalis] Length = 338 Score = 68.6 bits (166), Expect = 1e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGD 108 FYGMD+AGDFIPIKQLREKYNRPRHE+ +D +DEG+ Sbjct: 300 FYGMDAAGDFIPIKQLREKYNRPRHEIPIDPDDEGN 335 >gb|PON79631.1| Hemimethylated DNA-binding domain containing protein [Parasponia andersonii] Length = 348 Score = 68.6 bits (166), Expect = 1e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGD 108 FYGMD+AGDFIPIKQLREKYNRPRHE+ +D +DEG+ Sbjct: 310 FYGMDAAGDFIPIKQLREKYNRPRHEIPIDPDDEGN 345 >ref|XP_008339838.1| PREDICTED: uncharacterized protein LOC103402846 [Malus domestica] Length = 338 Score = 68.2 bits (165), Expect = 2e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGDDKN 117 FYGMD+AGDFIPIKQLREKYNRPRHE+ D DEG+ ++ Sbjct: 299 FYGMDAAGDFIPIKQLREKYNRPRHEIPYDPQDEGEGRD 337 >ref|XP_021997272.1| clp protease adapter protein ClpF, chloroplastic [Helianthus annuus] ref|XP_021997273.1| clp protease adapter protein ClpF, chloroplastic [Helianthus annuus] ref|XP_021997274.1| clp protease adapter protein ClpF, chloroplastic [Helianthus annuus] gb|OTG04485.1| putative uvrB/uvrC motif-containing protein [Helianthus annuus] Length = 333 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/39 (82%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDE--GDD 111 FYGMDSAGDFIP+KQLREKYNRPRHEV D DE GDD Sbjct: 294 FYGMDSAGDFIPVKQLREKYNRPRHEVPYDPQDEKSGDD 332 >ref|XP_006848709.1| clp protease adapter protein ClpF, chloroplastic [Amborella trichopoda] gb|ERN10290.1| hypothetical protein AMTR_s00177p00031030 [Amborella trichopoda] Length = 342 Score = 67.4 bits (163), Expect = 3e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGD 108 FYGMD+AGDF+PIKQLREKYNRPRHEV ++ NDE D Sbjct: 300 FYGMDTAGDFVPIKQLREKYNRPRHEVPVERNDEDD 335 >dbj|GAV74537.1| Macro domain-containing protein/UVR domain-containing protein/YccV-like domain-containing protein/CRAL_TRIO_2 domain-containing protein, partial [Cephalotus follicularis] Length = 951 Score = 67.8 bits (164), Expect = 3e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGD 108 FYGMD+AGDFIPIKQLREK+N+PRHEV +D DEGD Sbjct: 915 FYGMDAAGDFIPIKQLREKFNKPRHEVPIDPEDEGD 950 >ref|XP_021299790.1| clp protease adapter protein ClpF, chloroplastic isoform X2 [Herrania umbratica] Length = 335 Score = 66.2 bits (160), Expect = 8e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGDD 111 FYGMD+AGDFIPIKQLREKYNRPRHE+ LD EGDD Sbjct: 291 FYGMDAAGDFIPIKQLREKYNRPRHEIPLD--PEGDD 325 >ref|XP_021299789.1| clp protease adapter protein ClpF, chloroplastic isoform X1 [Herrania umbratica] Length = 343 Score = 66.2 bits (160), Expect = 8e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGDD 111 FYGMD+AGDFIPIKQLREKYNRPRHE+ LD EGDD Sbjct: 299 FYGMDAAGDFIPIKQLREKYNRPRHEIPLD--PEGDD 333 >ref|XP_010938850.1| PREDICTED: clp protease adapter protein ClpF, chloroplastic isoform X2 [Elaeis guineensis] Length = 336 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGDDKN 117 FYGMD+AGDFIPIKQLREK+NRPR+EV D++DE D N Sbjct: 297 FYGMDTAGDFIPIKQLREKFNRPRYEVPADMHDEDGDDN 335 >ref|XP_021807599.1| clp protease adapter protein ClpF, chloroplastic [Prunus avium] ref|XP_021807600.1| clp protease adapter protein ClpF, chloroplastic [Prunus avium] Length = 338 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEG 105 FYGMD+AGDFIPIKQLREKYNRPRHE+ D DEG Sbjct: 299 FYGMDAAGDFIPIKQLREKYNRPRHEIPFDPLDEG 333 >ref|XP_010938843.1| PREDICTED: clp protease adapter protein ClpF, chloroplastic isoform X1 [Elaeis guineensis] Length = 338 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEGDDKN 117 FYGMD+AGDFIPIKQLREK+NRPR+EV D++DE D N Sbjct: 299 FYGMDTAGDFIPIKQLREKFNRPRYEVPADMHDEDGDDN 337 >ref|XP_008221543.1| PREDICTED: uncharacterized protein LOC103321513 [Prunus mume] ref|XP_008221545.1| PREDICTED: uncharacterized protein LOC103321513 [Prunus mume] Length = 338 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDEG 105 FYGMD+AGDFIPIKQLREKYNRPRHE+ D DEG Sbjct: 299 FYGMDAAGDFIPIKQLREKYNRPRHEIPFDPLDEG 333 >ref|XP_023764592.1| clp protease adapter protein ClpF, chloroplastic isoform X2 [Lactuca sativa] ref|XP_023764593.1| clp protease adapter protein ClpF, chloroplastic isoform X2 [Lactuca sativa] Length = 334 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDE 102 FYGMDSAGDFIP+KQLREKYNRPRHEV D DE Sbjct: 295 FYGMDSAGDFIPVKQLREKYNRPRHEVPYDPKDE 328 >ref|XP_009388914.1| PREDICTED: uncharacterized protein LOC103975625 isoform X1 [Musa acuminata subsp. malaccensis] Length = 337 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDE 102 FYGMD+AGDFIPIKQLREKYN+PRHEV +D +DE Sbjct: 298 FYGMDTAGDFIPIKQLREKYNKPRHEVPVDTSDE 331 >ref|XP_023764591.1| clp protease adapter protein ClpF, chloroplastic isoform X1 [Lactuca sativa] Length = 378 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDE 102 FYGMDSAGDFIP+KQLREKYNRPRHEV D DE Sbjct: 339 FYGMDSAGDFIPVKQLREKYNRPRHEVPYDPKDE 372 >ref|XP_020091404.1| clp protease adapter protein ClpF, chloroplastic isoform X1 [Ananas comosus] ref|XP_020091405.1| clp protease adapter protein ClpF, chloroplastic isoform X1 [Ananas comosus] ref|XP_020091406.1| clp protease adapter protein ClpF, chloroplastic isoform X1 [Ananas comosus] Length = 335 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/40 (75%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLDVNDE-GDDKN 117 FYGMD+AGDFIPIKQLREKYNRPR+E + NDE G++KN Sbjct: 296 FYGMDTAGDFIPIKQLREKYNRPRYEAPFEQNDEDGNEKN 335 >ref|XP_020216477.1| clp protease adapter protein ClpF, chloroplastic [Cajanus cajan] gb|KYP65783.1| F-box only protein 21 [Cajanus cajan] Length = 338 Score = 65.1 bits (157), Expect = 2e-09 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +1 Query: 1 FYGMDSAGDFIPIKQLREKYNRPRHEVHLD-VNDEGDDK 114 FYGMDSAGDFIPIKQLREKYNRPRHE+ +D NDE K Sbjct: 299 FYGMDSAGDFIPIKQLREKYNRPRHEIPIDPPNDEDGGK 337