BLASTX nr result
ID: Ophiopogon25_contig00007520
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00007520 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS46462.1| hypothetical protein TRIUR3_11782 [Triticum urartu] 77 1e-15 gb|POE70644.1| hypothetical protein CFP56_40962 [Quercus suber] 58 8e-08 >gb|EMS46462.1| hypothetical protein TRIUR3_11782 [Triticum urartu] Length = 113 Score = 77.4 bits (189), Expect = 1e-15 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 9 GRDKHVRARGQEDEAWEAVQGVVWQLPPEEGEEDRADQGPDRDPQVHPLAPPLQAHL 179 GRD VRARGQED+A EAVQG++ QL E GEEDRA QGP R +HP+APPLQAHL Sbjct: 26 GRD--VRARGQEDQAREAVQGLLRQLAAEAGEEDRAHQGPRRGAPLHPVAPPLQAHL 80 >gb|POE70644.1| hypothetical protein CFP56_40962 [Quercus suber] Length = 134 Score = 57.8 bits (138), Expect = 8e-08 Identities = 29/57 (50%), Positives = 31/57 (54%) Frame = -1 Query: 176 MSLKGRGQGVDXXXXXXXXXXXXXXXXXXRELPYDPLNRFPRFVFLSPRPHVLIAPS 6 MSLKGRGQGVD E PYDPLN FP VFLSPRPH + P+ Sbjct: 1 MSLKGRGQGVDLGTSTRSLIRSIFFSFLGLEFPYDPLNLFPFLVFLSPRPHTIGTPT 57