BLASTX nr result
ID: Ophiopogon25_contig00006343
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00006343 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020080892.1| prefoldin subunit 1-like [Ananas comosus] >g... 81 9e-17 dbj|GAV59727.1| Prefoldin_2 domain-containing protein [Cephalotu... 79 3e-16 gb|KMT17650.1| hypothetical protein BVRB_2g035980 [Beta vulgaris... 79 4e-16 ref|XP_010669617.1| PREDICTED: prefoldin subunit 1 isoform X4 [B... 79 4e-16 ref|XP_010669616.1| PREDICTED: prefoldin subunit 1 isoform X3 [B... 79 4e-16 ref|XP_010669614.1| PREDICTED: prefoldin subunit 1 isoform X2 [B... 79 4e-16 ref|XP_010669613.1| PREDICTED: prefoldin subunit 1 isoform X1 [B... 79 5e-16 ref|XP_010929319.1| PREDICTED: prefoldin subunit 1 [Elaeis guine... 78 1e-15 ref|XP_021605063.1| prefoldin subunit 1 [Manihot esculenta] >gi|... 78 1e-15 ref|XP_011019945.1| PREDICTED: prefoldin subunit 1-like [Populus... 78 1e-15 ref|XP_003574948.1| PREDICTED: prefoldin subunit 1 [Brachypodium... 78 1e-15 ref|XP_002308134.1| prefoldin-related KE2 family protein [Populu... 78 1e-15 ref|XP_021642189.1| prefoldin subunit 1-like [Hevea brasiliensis] 77 2e-15 ref|XP_021642198.1| prefoldin subunit 1-like [Hevea brasiliensis] 77 4e-15 ref|XP_008799451.1| PREDICTED: prefoldin subunit 1 [Phoenix dact... 77 4e-15 ref|XP_021715860.1| prefoldin subunit 1-like [Chenopodium quinoa... 76 8e-15 ref|XP_015623225.1| PREDICTED: prefoldin subunit 1 [Oryza sativa... 76 8e-15 ref|NP_001148596.1| uncharacterized protein LOC100282212 [Zea ma... 76 8e-15 gb|ACG24730.1| prefoldin subunit 1 [Zea mays] >gi|219884055|gb|A... 76 8e-15 gb|KDP27743.1| hypothetical protein JCGZ_19772 [Jatropha curcas] 75 1e-14 >ref|XP_020080892.1| prefoldin subunit 1-like [Ananas comosus] ref|XP_020109721.1| prefoldin subunit 1-like [Ananas comosus] Length = 129 Score = 80.9 bits (198), Expect = 9e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIGKVFVLEPKSLL+NEQ+QKLKDSE AI+SLQ Sbjct: 49 RQLPDDTNTYKSIGKVFVLEPKSLLVNEQEQKLKDSESAISSLQ 92 >dbj|GAV59727.1| Prefoldin_2 domain-containing protein [Cephalotus follicularis] Length = 113 Score = 79.0 bits (193), Expect = 3e-16 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+P+DTNTYKSIG+ FVLEPKS+LMNEQ+QKLKDSE AIASLQ Sbjct: 33 RQLPEDTNTYKSIGRTFVLEPKSVLMNEQEQKLKDSEAAIASLQ 76 >gb|KMT17650.1| hypothetical protein BVRB_2g035980 [Beta vulgaris subsp. vulgaris] Length = 129 Score = 79.3 bits (194), Expect = 4e-16 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIG+ FVLEPKS+L+NEQ+QKLKDSE AIASLQ Sbjct: 49 RQVPDDTNTYKSIGRTFVLEPKSVLINEQEQKLKDSETAIASLQ 92 >ref|XP_010669617.1| PREDICTED: prefoldin subunit 1 isoform X4 [Beta vulgaris subsp. vulgaris] Length = 130 Score = 79.3 bits (194), Expect = 4e-16 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIG+ FVLEPKS+L+NEQ+QKLKDSE AIASLQ Sbjct: 49 RQVPDDTNTYKSIGRTFVLEPKSVLINEQEQKLKDSETAIASLQ 92 >ref|XP_010669616.1| PREDICTED: prefoldin subunit 1 isoform X3 [Beta vulgaris subsp. vulgaris] Length = 130 Score = 79.3 bits (194), Expect = 4e-16 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIG+ FVLEPKS+L+NEQ+QKLKDSE AIASLQ Sbjct: 49 RQVPDDTNTYKSIGRTFVLEPKSVLINEQEQKLKDSETAIASLQ 92 >ref|XP_010669614.1| PREDICTED: prefoldin subunit 1 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 134 Score = 79.3 bits (194), Expect = 4e-16 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIG+ FVLEPKS+L+NEQ+QKLKDSE AIASLQ Sbjct: 49 RQVPDDTNTYKSIGRTFVLEPKSVLINEQEQKLKDSETAIASLQ 92 >ref|XP_010669613.1| PREDICTED: prefoldin subunit 1 isoform X1 [Beta vulgaris subsp. vulgaris] Length = 140 Score = 79.3 bits (194), Expect = 5e-16 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIG+ FVLEPKS+L+NEQ+QKLKDSE AIASLQ Sbjct: 49 RQVPDDTNTYKSIGRTFVLEPKSVLINEQEQKLKDSETAIASLQ 92 >ref|XP_010929319.1| PREDICTED: prefoldin subunit 1 [Elaeis guineensis] Length = 129 Score = 78.2 bits (191), Expect = 1e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIGKVFVLEPK LL+NEQ+QK KDSE AI+SLQ Sbjct: 49 RQLPDDTNTYKSIGKVFVLEPKLLLLNEQEQKFKDSETAISSLQ 92 >ref|XP_021605063.1| prefoldin subunit 1 [Manihot esculenta] ref|XP_021605064.1| prefoldin subunit 1 [Manihot esculenta] gb|OAY58676.1| hypothetical protein MANES_02G198400 [Manihot esculenta] Length = 129 Score = 77.8 bits (190), Expect = 1e-15 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PD+TNTYKSIG+ F+LEPKS+LMNEQ+QKLKDSE A+ASLQ Sbjct: 49 RQLPDETNTYKSIGRTFILEPKSVLMNEQEQKLKDSETALASLQ 92 >ref|XP_011019945.1| PREDICTED: prefoldin subunit 1-like [Populus euphratica] ref|XP_011010262.1| PREDICTED: prefoldin subunit 1-like [Populus euphratica] Length = 129 Score = 77.8 bits (190), Expect = 1e-15 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIG+ FVLEPKS+LM+EQ+QKLKDSE AI+SLQ Sbjct: 49 RQVPDDTNTYKSIGRTFVLEPKSVLMSEQEQKLKDSETAISSLQ 92 >ref|XP_003574948.1| PREDICTED: prefoldin subunit 1 [Brachypodium distachyon] gb|KQJ99401.1| hypothetical protein BRADI_3g43090v3 [Brachypodium distachyon] Length = 129 Score = 77.8 bits (190), Expect = 1e-15 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYK+IGKVF+LEP+S+LMNEQ+QKL DSE AIAS+Q Sbjct: 49 RQLPDDTNTYKTIGKVFILEPRSVLMNEQEQKLNDSETAIASMQ 92 >ref|XP_002308134.1| prefoldin-related KE2 family protein [Populus trichocarpa] gb|ABK93219.1| unknown [Populus trichocarpa] gb|PNT30405.1| hypothetical protein POPTR_006G079700v3 [Populus trichocarpa] Length = 129 Score = 77.8 bits (190), Expect = 1e-15 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIG+ FVLEPKS+LM+EQ+QKLKDSE AI+SLQ Sbjct: 49 RQVPDDTNTYKSIGRTFVLEPKSVLMSEQEQKLKDSETAISSLQ 92 >ref|XP_021642189.1| prefoldin subunit 1-like [Hevea brasiliensis] Length = 129 Score = 77.4 bits (189), Expect = 2e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIG+ FVLEPKS+LM+EQ+QKLKDSE AIASLQ Sbjct: 49 RQLPDDTNTYKSIGRTFVLEPKSVLMSEQEQKLKDSENAIASLQ 92 >ref|XP_021642198.1| prefoldin subunit 1-like [Hevea brasiliensis] Length = 129 Score = 76.6 bits (187), Expect = 4e-15 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIG+ FVLEPKS+LM+EQ+QKLKDSE A ASLQ Sbjct: 49 RQLPDDTNTYKSIGRTFVLEPKSVLMSEQEQKLKDSETATASLQ 92 >ref|XP_008799451.1| PREDICTED: prefoldin subunit 1 [Phoenix dactylifera] Length = 129 Score = 76.6 bits (187), Expect = 4e-15 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIGK FVLEPK LL+NEQ+QK KDSE AI+SLQ Sbjct: 49 RQLPDDTNTYKSIGKAFVLEPKLLLLNEQEQKFKDSETAISSLQ 92 >ref|XP_021715860.1| prefoldin subunit 1-like [Chenopodium quinoa] ref|XP_021744150.1| prefoldin subunit 1-like [Chenopodium quinoa] Length = 129 Score = 75.9 bits (185), Expect = 8e-15 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYKSIG+ FVLEPKS+L++EQ+QK KDSE AIASLQ Sbjct: 49 RQVPDDTNTYKSIGRTFVLEPKSVLIDEQEQKFKDSETAIASLQ 92 >ref|XP_015623225.1| PREDICTED: prefoldin subunit 1 [Oryza sativa Japonica Group] dbj|BAH01492.1| unnamed protein product [Oryza sativa Japonica Group] gb|EEC73122.1| hypothetical protein OsI_07131 [Oryza sativa Indica Group] gb|EEE56943.1| hypothetical protein OsJ_06647 [Oryza sativa Japonica Group] Length = 129 Score = 75.9 bits (185), Expect = 8e-15 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PD+TNTYK++GKVF+LEPKSLL+NEQ+QKL DSE AIAS+Q Sbjct: 49 RQLPDNTNTYKTVGKVFILEPKSLLLNEQEQKLNDSESAIASMQ 92 >ref|NP_001148596.1| uncharacterized protein LOC100282212 [Zea mays] gb|ACG32168.1| prefoldin subunit 1 [Zea mays] Length = 129 Score = 75.9 bits (185), Expect = 8e-15 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYK++GKVF+LEPKS+L NEQ+QKL DSE AIAS+Q Sbjct: 49 RQLPDDTNTYKTVGKVFILEPKSVLFNEQEQKLNDSESAIASMQ 92 >gb|ACG24730.1| prefoldin subunit 1 [Zea mays] gb|ACL52402.1| unknown [Zea mays] Length = 129 Score = 75.9 bits (185), Expect = 8e-15 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PDDTNTYK++GKVF+LEPKS+L NEQ+QKL DSE AIAS+Q Sbjct: 49 RQLPDDTNTYKTVGKVFILEPKSVLFNEQEQKLNDSESAIASMQ 92 >gb|KDP27743.1| hypothetical protein JCGZ_19772 [Jatropha curcas] Length = 99 Score = 74.7 bits (182), Expect = 1e-14 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = +2 Query: 2 RQIPDDTNTYKSIGKVFVLEPKSLLMNEQDQKLKDSEVAIASLQ 133 RQ+PD+TNTYKSIG+ F+LEPK +LM+EQ+QKLKDSE AIASLQ Sbjct: 19 RQLPDETNTYKSIGRTFILEPKPVLMSEQEQKLKDSETAIASLQ 62