BLASTX nr result
ID: Ophiopogon25_contig00006247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00006247 (535 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017249429.1| PREDICTED: chaperone protein dnaJ 8, chlorop... 60 3e-08 ref|XP_019267692.1| PREDICTED: chaperone protein dnaJ 8, chlorop... 54 8e-06 ref|XP_022842668.1| chaperone protein dnaJ 8, chloroplastic-like... 54 9e-06 >ref|XP_017249429.1| PREDICTED: chaperone protein dnaJ 8, chloroplastic-like [Daucus carota subsp. sativus] ref|XP_017252615.1| PREDICTED: chaperone protein dnaJ 8, chloroplastic-like [Daucus carota subsp. sativus] gb|KZM93062.1| hypothetical protein DCAR_016307 [Daucus carota subsp. sativus] gb|KZM93063.1| hypothetical protein DCAR_016308 [Daucus carota subsp. sativus] Length = 158 Score = 60.5 bits (145), Expect = 3e-08 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +2 Query: 38 GNDDDDQMRGMYDSNWDXXXXXXXXXXAGIRDYSSHINPYI 160 G++DD+QMRGMYD +WD AGIRDYSSHINPYI Sbjct: 118 GDEDDEQMRGMYDPDWDMWEEWMGWEGAGIRDYSSHINPYI 158 >ref|XP_019267692.1| PREDICTED: chaperone protein dnaJ 8, chloroplastic-like [Nicotiana attenuata] gb|OIT34209.1| chaperone protein dnaj 8, chloroplastic [Nicotiana attenuata] Length = 160 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = +2 Query: 44 DDDDQMRGMYDSNWDXXXXXXXXXXAGIRDYSSHINPYI 160 DDDD MRG+ D +WD AGIRDYSSHINPYI Sbjct: 122 DDDDSMRGVNDPDWDMWEEWMGWEGAGIRDYSSHINPYI 160 >ref|XP_022842668.1| chaperone protein dnaJ 8, chloroplastic-like [Olea europaea var. sylvestris] Length = 148 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +2 Query: 47 DDDQMRGMYDSNWDXXXXXXXXXXAGIRDYSSHINPYI 160 DD+QMRGM D +WD AGIRDYSSHINPYI Sbjct: 111 DDEQMRGMDDQDWDLWEEWMGWEGAGIRDYSSHINPYI 148