BLASTX nr result
ID: Ophiopogon25_contig00006231
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00006231 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012466927.1| PREDICTED: probable plastid-lipid-associated... 62 3e-08 >ref|XP_012466927.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic isoform X1 [Gossypium raimondii] Length = 304 Score = 61.6 bits (148), Expect = 3e-08 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 7/64 (10%) Frame = -1 Query: 462 EGWLDITYPLSLQVY*EFIFA----IMSFCFSLN---KFRYVDDCLRIGRDDKGNIFVLE 304 EGWL+ITYPL + ++F + S C SL+ RYVDD +RIGRDDKGNIF+LE Sbjct: 238 EGWLEITYPLLFLLVFWWMFCGINIVTSHCCSLSWVEHCRYVDDRMRIGRDDKGNIFILE 297 Query: 303 RTGE 292 R+ E Sbjct: 298 RSEE 301