BLASTX nr result
ID: Ophiopogon25_contig00006208
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00006208 (443 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242084.1| proteasome-associated protein ECM29 homolog ... 73 5e-12 ref|XP_020242083.1| proteasome-associated protein ECM29 homolog ... 73 5e-12 ref|XP_020242082.1| proteasome-associated protein ECM29 homolog ... 73 5e-12 ref|XP_010922049.1| PREDICTED: proteasome-associated protein ECM... 65 3e-09 ref|XP_010922048.1| PREDICTED: proteasome-associated protein ECM... 65 3e-09 ref|XP_010922045.1| PREDICTED: proteasome-associated protein ECM... 65 3e-09 gb|OAY74829.1| Proteasome-associated protein ECM [Ananas comosus] 58 6e-07 gb|PKA49156.1| hypothetical protein AXF42_Ash010841 [Apostasia s... 58 8e-07 ref|XP_020113730.1| proteasome-associated protein ECM29 homolog ... 57 2e-06 ref|XP_020113729.1| proteasome-associated protein ECM29 homolog ... 57 2e-06 ref|XP_020113728.1| proteasome-associated protein ECM29 homolog ... 57 2e-06 ref|XP_009410433.1| PREDICTED: proteasome-associated protein ECM... 56 4e-06 >ref|XP_020242084.1| proteasome-associated protein ECM29 homolog isoform X3 [Asparagus officinalis] Length = 1637 Score = 72.8 bits (177), Expect = 5e-12 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELWGEDAQMI 300 P+ +R+N+EF DELIHLCEVEKSEQAKTLL+KV+A+LEEL E+ M+ Sbjct: 1588 PSEQRKNIEFSDELIHLCEVEKSEQAKTLLQKVVALLEELGEENTPMV 1635 >ref|XP_020242083.1| proteasome-associated protein ECM29 homolog isoform X2 [Asparagus officinalis] Length = 1793 Score = 72.8 bits (177), Expect = 5e-12 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELWGEDAQMI 300 P+ +R+N+EF DELIHLCEVEKSEQAKTLL+KV+A+LEEL E+ M+ Sbjct: 1744 PSEQRKNIEFSDELIHLCEVEKSEQAKTLLQKVVALLEELGEENTPMV 1791 >ref|XP_020242082.1| proteasome-associated protein ECM29 homolog isoform X1 [Asparagus officinalis] gb|ONK61486.1| uncharacterized protein A4U43_C08F30410 [Asparagus officinalis] Length = 1813 Score = 72.8 bits (177), Expect = 5e-12 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELWGEDAQMI 300 P+ +R+N+EF DELIHLCEVEKSEQAKTLL+KV+A+LEEL E+ M+ Sbjct: 1764 PSEQRKNIEFSDELIHLCEVEKSEQAKTLLQKVVALLEELGEENTPMV 1811 >ref|XP_010922049.1| PREDICTED: proteasome-associated protein ECM29 homolog isoform X3 [Elaeis guineensis] Length = 1763 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELWGEDAQM 303 P +R+++EF+DEL+HLCEVEKSEQAKTLLRK +AI E+L E M Sbjct: 1716 PLTQRKHIEFKDELVHLCEVEKSEQAKTLLRKCLAIFEDLDREITSM 1762 >ref|XP_010922048.1| PREDICTED: proteasome-associated protein ECM29 homolog isoform X2 [Elaeis guineensis] Length = 1814 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELWGEDAQM 303 P +R+++EF+DEL+HLCEVEKSEQAKTLLRK +AI E+L E M Sbjct: 1767 PLTQRKHIEFKDELVHLCEVEKSEQAKTLLRKCLAIFEDLDREITSM 1813 >ref|XP_010922045.1| PREDICTED: proteasome-associated protein ECM29 homolog isoform X1 [Elaeis guineensis] Length = 1819 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELWGEDAQM 303 P +R+++EF+DEL+HLCEVEKSEQAKTLLRK +AI E+L E M Sbjct: 1772 PLTQRKHIEFKDELVHLCEVEKSEQAKTLLRKCLAIFEDLDREITSM 1818 >gb|OAY74829.1| Proteasome-associated protein ECM [Ananas comosus] Length = 1818 Score = 58.2 bits (139), Expect = 6e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEEL 324 P R+N+EF+D L HLC VEKSEQAKT+LRK AILEEL Sbjct: 1772 PLEYRKNIEFKDALTHLCGVEKSEQAKTVLRKCTAILEEL 1811 >gb|PKA49156.1| hypothetical protein AXF42_Ash010841 [Apostasia shenzhenica] Length = 1818 Score = 57.8 bits (138), Expect = 8e-07 Identities = 30/48 (62%), Positives = 37/48 (77%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELWGEDAQMI 300 P +RR+VEF+DELIHL EVE+SEQAKT + IA+LEEL E +MI Sbjct: 1771 PPDQRRHVEFKDELIHLSEVERSEQAKTSFTRSIAVLEELDKEVDEMI 1818 >ref|XP_020113730.1| proteasome-associated protein ECM29 homolog isoform X3 [Ananas comosus] Length = 1581 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEEL 324 P R+N+EF+D L HLC VEKSEQAKT+LRK ILEEL Sbjct: 1535 PLEYRKNIEFKDALAHLCGVEKSEQAKTVLRKCTTILEEL 1574 >ref|XP_020113729.1| proteasome-associated protein ECM29 homolog isoform X2 [Ananas comosus] Length = 1817 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEEL 324 P R+N+EF+D L HLC VEKSEQAKT+LRK ILEEL Sbjct: 1771 PLEYRKNIEFKDALAHLCGVEKSEQAKTVLRKCTTILEEL 1810 >ref|XP_020113728.1| proteasome-associated protein ECM29 homolog isoform X1 [Ananas comosus] Length = 1818 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -1 Query: 443 PAAERRNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEEL 324 P R+N+EF+D L HLC VEKSEQAKT+LRK ILEEL Sbjct: 1772 PLEYRKNIEFKDALAHLCGVEKSEQAKTVLRKCTTILEEL 1811 >ref|XP_009410433.1| PREDICTED: proteasome-associated protein ECM29 homolog [Musa acuminata subsp. malaccensis] Length = 1816 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 425 NVEFQDELIHLCEVEKSEQAKTLLRKVIAILEEL 324 +VE +DEL+HLCEVEKSEQAKTLLR+ I ILE+L Sbjct: 1772 DVELKDELVHLCEVEKSEQAKTLLRQCITILEDL 1805