BLASTX nr result
ID: Ophiopogon25_contig00006106
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00006106 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265584.1| CBS domain-containing protein CBSX1, chlorop... 59 3e-07 ref|XP_008779985.1| PREDICTED: CBS domain-containing protein CBS... 55 3e-07 ref|XP_017699379.1| PREDICTED: CBS domain-containing protein CBS... 58 4e-07 ref|XP_008795892.1| PREDICTED: CBS domain-containing protein CBS... 58 5e-07 gb|PON67171.1| CBS domain containing protein [Trema orientalis] 57 1e-06 gb|PON42980.1| CBS domain containing protein [Parasponia anderso... 57 1e-06 ref|XP_023879737.1| CBS domain-containing protein CBSX2, chlorop... 57 1e-06 ref|XP_020103390.1| CBS domain-containing protein CBSX1, chlorop... 57 1e-06 ref|XP_015066731.1| PREDICTED: CBS domain-containing protein CBS... 57 1e-06 ref|XP_006360213.1| PREDICTED: CBS domain-containing protein CBS... 57 1e-06 ref|XP_004233443.1| PREDICTED: CBS domain-containing protein CBS... 57 1e-06 ref|XP_020103389.1| CBS domain-containing protein CBSX1, chlorop... 57 1e-06 ref|XP_008456144.1| PREDICTED: CBS domain-containing protein CBS... 56 2e-06 ref|XP_004140707.1| PREDICTED: CBS domain-containing protein CBS... 56 2e-06 gb|OAY78552.1| CBS domain-containing protein CBSX1, chloroplasti... 56 2e-06 gb|PIA56558.1| hypothetical protein AQUCO_00700716v1 [Aquilegia ... 57 2e-06 gb|OMO74107.1| Cystathionine beta-synthase, core [Corchorus caps... 56 2e-06 gb|OMO63240.1| Cystathionine beta-synthase, core [Corchorus olit... 56 2e-06 ref|XP_010906559.1| PREDICTED: CBS domain-containing protein CBS... 56 3e-06 ref|XP_009400310.1| PREDICTED: CBS domain-containing protein CBS... 55 3e-06 >ref|XP_020265584.1| CBS domain-containing protein CBSX1, chloroplastic [Asparagus officinalis] Length = 240 Score = 58.5 bits (140), Expect = 3e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKSTQA 367 LPVVDS GKLVGIITRGNVVRAAL IKR +EKS++A Sbjct: 205 LPVVDSTGKLVGIITRGNVVRAALAIKREIEKSSKA 240 >ref|XP_008779985.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Phoenix dactylifera] Length = 90 Score = 55.5 bits (132), Expect = 3e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKSTQ 370 LP+VD+AGKLVGIITRGNVVRAAL+IK E+++Q Sbjct: 55 LPIVDNAGKLVGIITRGNVVRAALQIKHASERNSQ 89 >ref|XP_017699379.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like isoform X3 [Phoenix dactylifera] Length = 206 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKSTQ 370 LPVVDSAGKL+GIITRGNVVRAAL+IK EK++Q Sbjct: 171 LPVVDSAGKLIGIITRGNVVRAALQIKHASEKNSQ 205 >ref|XP_008795892.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like isoform X1 [Phoenix dactylifera] Length = 240 Score = 57.8 bits (138), Expect = 5e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKSTQ 370 LPVVDSAGKL+GIITRGNVVRAAL+IK EK++Q Sbjct: 205 LPVVDSAGKLIGIITRGNVVRAALQIKHASEKNSQ 239 >gb|PON67171.1| CBS domain containing protein [Trema orientalis] Length = 249 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKST 373 LPVVDS GKLVGIITRGNVVRAAL+IKR EK T Sbjct: 216 LPVVDSDGKLVGIITRGNVVRAALQIKRASEKKT 249 >gb|PON42980.1| CBS domain containing protein [Parasponia andersonii] Length = 249 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKST 373 LPVVDS GKLVGIITRGNVVRAAL+IKR EK T Sbjct: 216 LPVVDSDGKLVGIITRGNVVRAALQIKRASEKKT 249 >ref|XP_023879737.1| CBS domain-containing protein CBSX2, chloroplastic-like [Quercus suber] gb|POF23047.1| cbs domain-containing protein cbsx2, chloroplastic [Quercus suber] Length = 254 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKST 373 LPVVD GKLVGIITRGNVVRAAL+IKR EKST Sbjct: 221 LPVVDGDGKLVGIITRGNVVRAALQIKRASEKST 254 >ref|XP_020103390.1| CBS domain-containing protein CBSX1, chloroplastic-like isoform X2 [Ananas comosus] Length = 236 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKST 373 LPVVDSAGKLVGI+TRGNVVRAAL+IK EKS+ Sbjct: 203 LPVVDSAGKLVGILTRGNVVRAALQIKHASEKSS 236 >ref|XP_015066731.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Solanum pennellii] Length = 236 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKSTQ 370 LPVVDS GKLVGIITRGNVVRAAL IKR+ME Q Sbjct: 201 LPVVDSDGKLVGIITRGNVVRAALHIKRIMEMEGQ 235 >ref|XP_006360213.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Solanum tuberosum] Length = 236 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKSTQ 370 LPVVDS GKLVGIITRGNVVRAAL IKR+ME Q Sbjct: 201 LPVVDSDGKLVGIITRGNVVRAALHIKRIMEMEGQ 235 >ref|XP_004233443.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic [Solanum lycopersicum] Length = 236 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKSTQ 370 LPVVDS GKLVGIITRGNVVRAAL IKR+ME Q Sbjct: 201 LPVVDSDGKLVGIITRGNVVRAALHIKRIMEMEGQ 235 >ref|XP_020103389.1| CBS domain-containing protein CBSX1, chloroplastic-like isoform X1 [Ananas comosus] Length = 242 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKST 373 LPVVDSAGKLVGI+TRGNVVRAAL+IK EKS+ Sbjct: 209 LPVVDSAGKLVGILTRGNVVRAALQIKHASEKSS 242 >ref|XP_008456144.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Cucumis melo] Length = 239 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKST 373 LPVVD+ GKLVGIITRGNVVRAAL+IKR E+ST Sbjct: 206 LPVVDADGKLVGIITRGNVVRAALQIKRAAERST 239 >ref|XP_004140707.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Cucumis sativus] gb|KGN57513.1| hypothetical protein Csa_3G202220 [Cucumis sativus] Length = 239 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKST 373 LPVVD+ GKLVGIITRGNVVRAAL+IKR E+ST Sbjct: 206 LPVVDADGKLVGIITRGNVVRAALQIKRAAERST 239 >gb|OAY78552.1| CBS domain-containing protein CBSX1, chloroplastic [Ananas comosus] Length = 242 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKST 373 LPVVDSAGKLVGI+TRGNVVRAAL+IK EKS+ Sbjct: 209 LPVVDSAGKLVGILTRGNVVRAALQIKHANEKSS 242 >gb|PIA56558.1| hypothetical protein AQUCO_00700716v1 [Aquilegia coerulea] Length = 373 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKS 376 LPVVDS GKLVGIITRGNVVRAAL IKR +EKS Sbjct: 340 LPVVDSVGKLVGIITRGNVVRAALHIKREIEKS 372 >gb|OMO74107.1| Cystathionine beta-synthase, core [Corchorus capsularis] Length = 233 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKST 373 LPVVD GKLVGIITRGNVVRAAL+IKR E+ST Sbjct: 200 LPVVDGDGKLVGIITRGNVVRAALQIKRASERST 233 >gb|OMO63240.1| Cystathionine beta-synthase, core [Corchorus olitorius] Length = 233 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKST 373 LPVVD GKLVGIITRGNVVRAAL+IKR E+ST Sbjct: 200 LPVVDGDGKLVGIITRGNVVRAALQIKRASERST 233 >ref|XP_010906559.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic [Elaeis guineensis] ref|XP_010906560.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic [Elaeis guineensis] Length = 237 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 471 PVVDSAGKLVGIITRGNVVRAALEIKRLMEKSTQ 370 PVVDSAGKL+GIITRGNVV AAL+IKR EK++Q Sbjct: 203 PVVDSAGKLIGIITRGNVVSAALQIKRASEKNSQ 236 >ref|XP_009400310.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic isoform X2 [Musa acuminata subsp. malaccensis] Length = 233 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 474 LPVVDSAGKLVGIITRGNVVRAALEIKRLMEKSTQ 370 LPVVDSAG+LVGIITRGNVVRAAL+IK E+++Q Sbjct: 198 LPVVDSAGRLVGIITRGNVVRAALQIKHANERNSQ 232