BLASTX nr result
ID: Ophiopogon25_contig00005695
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00005695 (2115 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY82852.1| Dr1-associated corepressor [Ananas comosus] 67 2e-08 ref|XP_020274183.1| dr1-associated corepressor-like [Asparagus o... 66 3e-08 ref|XP_020685197.1| dr1-associated corepressor-like isoform X3 [... 65 7e-08 ref|XP_020685196.1| dr1-associated corepressor-like isoform X2 [... 65 9e-08 ref|XP_020685195.1| dr1-associated corepressor-like isoform X1 [... 65 9e-08 ref|XP_020257085.1| dr1-associated corepressor-like isoform X2 [... 64 1e-07 ref|XP_020257084.1| dr1-associated corepressor-like isoform X1 [... 64 1e-07 ref|XP_020104831.1| dr1-associated corepressor homolog isoform X... 64 2e-07 ref|XP_020580310.1| dr1-associated corepressor-like isoform X1 [... 64 2e-07 ref|XP_020104829.1| dr1-associated corepressor-like isoform X1 [... 64 3e-07 ref|XP_010916576.1| PREDICTED: dr1-associated corepressor isofor... 62 6e-07 ref|XP_008782238.1| PREDICTED: dr1-associated corepressor homolo... 62 6e-07 ref|XP_010916575.1| PREDICTED: dr1-associated corepressor isofor... 62 8e-07 ref|XP_008782237.1| PREDICTED: dr1-associated corepressor homolo... 62 8e-07 ref|XP_008802064.1| PREDICTED: dr1-associated corepressor-like [... 62 8e-07 ref|XP_020586771.1| dr1-associated corepressor-like isoform X2 [... 61 2e-06 ref|XP_020586770.1| dr1-associated corepressor-like isoform X1 [... 61 2e-06 ref|XP_010926426.1| PREDICTED: dr1-associated corepressor homolo... 60 4e-06 ref|XP_010926425.1| PREDICTED: dr1-associated corepressor homolo... 60 5e-06 >gb|OAY82852.1| Dr1-associated corepressor [Ananas comosus] Length = 241 Score = 66.6 bits (161), Expect = 2e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 106 SRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 SRKQCVKMYS+FDFL+DVVNKVPN+GGTE GDEK Sbjct: 46 SRKQCVKMYSAFDFLTDVVNKVPNIGGTEPCGDEK 80 >ref|XP_020274183.1| dr1-associated corepressor-like [Asparagus officinalis] gb|ONK65466.1| uncharacterized protein A4U43_C07F37400 [Asparagus officinalis] Length = 250 Score = 66.2 bits (160), Expect = 3e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -3 Query: 100 KQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 KQCVKMYSSFDFLSDVVNKVPNLGG ES GDEK Sbjct: 68 KQCVKMYSSFDFLSDVVNKVPNLGGAESCGDEK 100 >ref|XP_020685197.1| dr1-associated corepressor-like isoform X3 [Dendrobium catenatum] Length = 228 Score = 64.7 bits (156), Expect = 7e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVKMY +FDFL+DVVNKVPNLGGTES GDEK Sbjct: 48 LHLKQCVKMYGAFDFLTDVVNKVPNLGGTESFGDEK 83 >ref|XP_020685196.1| dr1-associated corepressor-like isoform X2 [Dendrobium catenatum] Length = 244 Score = 64.7 bits (156), Expect = 9e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVKMY +FDFL+DVVNKVPNLGGTES GDEK Sbjct: 65 LHLKQCVKMYGAFDFLTDVVNKVPNLGGTESFGDEK 100 >ref|XP_020685195.1| dr1-associated corepressor-like isoform X1 [Dendrobium catenatum] gb|PKU69472.1| Nuclear transcription factor Y subunit C-3 [Dendrobium catenatum] Length = 245 Score = 64.7 bits (156), Expect = 9e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVKMY +FDFL+DVVNKVPNLGGTES GDEK Sbjct: 65 LHLKQCVKMYGAFDFLTDVVNKVPNLGGTESFGDEK 100 >ref|XP_020257085.1| dr1-associated corepressor-like isoform X2 [Asparagus officinalis] Length = 249 Score = 64.3 bits (155), Expect = 1e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 100 KQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 KQCVKMYSSFDFLSDVVNKVPNLGG E GDEK Sbjct: 63 KQCVKMYSSFDFLSDVVNKVPNLGGAEPCGDEK 95 >ref|XP_020257084.1| dr1-associated corepressor-like isoform X1 [Asparagus officinalis] gb|ONK75229.1| uncharacterized protein A4U43_C03F14700 [Asparagus officinalis] Length = 254 Score = 64.3 bits (155), Expect = 1e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 100 KQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 KQCVKMYSSFDFLSDVVNKVPNLGG E GDEK Sbjct: 68 KQCVKMYSSFDFLSDVVNKVPNLGGAEPCGDEK 100 >ref|XP_020104831.1| dr1-associated corepressor homolog isoform X2 [Ananas comosus] Length = 230 Score = 63.5 bits (153), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVKMYS+FDFL+DVVNKVPN+GGTE GDEK Sbjct: 34 LHLKQCVKMYSAFDFLTDVVNKVPNIGGTEPCGDEK 69 >ref|XP_020580310.1| dr1-associated corepressor-like isoform X1 [Phalaenopsis equestris] ref|XP_020580311.1| dr1-associated corepressor-like isoform X2 [Phalaenopsis equestris] Length = 247 Score = 63.5 bits (153), Expect = 2e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 100 KQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 KQCVKMYS+FDFL+DVVNKVPNLGG ES GDEK Sbjct: 68 KQCVKMYSAFDFLTDVVNKVPNLGGIESVGDEK 100 >ref|XP_020104829.1| dr1-associated corepressor-like isoform X1 [Ananas comosus] Length = 261 Score = 63.5 bits (153), Expect = 3e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVKMYS+FDFL+DVVNKVPN+GGTE GDEK Sbjct: 65 LHLKQCVKMYSAFDFLTDVVNKVPNIGGTEPCGDEK 100 >ref|XP_010916576.1| PREDICTED: dr1-associated corepressor isoform X2 [Elaeis guineensis] Length = 235 Score = 62.0 bits (149), Expect = 6e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVK YS+FDFL+DVVNKVPNLGGTE GDEK Sbjct: 48 LHLKQCVKSYSAFDFLTDVVNKVPNLGGTEPYGDEK 83 >ref|XP_008782238.1| PREDICTED: dr1-associated corepressor homolog isoform X2 [Phoenix dactylifera] Length = 235 Score = 62.0 bits (149), Expect = 6e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVK YS+FDFL+DVVNKVPNLGGTE GDEK Sbjct: 48 LHLKQCVKSYSAFDFLTDVVNKVPNLGGTEPCGDEK 83 >ref|XP_010916575.1| PREDICTED: dr1-associated corepressor isoform X1 [Elaeis guineensis] Length = 252 Score = 62.0 bits (149), Expect = 8e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVK YS+FDFL+DVVNKVPNLGGTE GDEK Sbjct: 65 LHLKQCVKSYSAFDFLTDVVNKVPNLGGTEPYGDEK 100 >ref|XP_008782237.1| PREDICTED: dr1-associated corepressor homolog isoform X1 [Phoenix dactylifera] Length = 252 Score = 62.0 bits (149), Expect = 8e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVK YS+FDFL+DVVNKVPNLGGTE GDEK Sbjct: 65 LHLKQCVKSYSAFDFLTDVVNKVPNLGGTEPCGDEK 100 >ref|XP_008802064.1| PREDICTED: dr1-associated corepressor-like [Phoenix dactylifera] Length = 254 Score = 62.0 bits (149), Expect = 8e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVK YS+FDFL+DVVNKVPNLGGTE GDEK Sbjct: 65 LHLKQCVKSYSAFDFLTDVVNKVPNLGGTEPCGDEK 100 >ref|XP_020586771.1| dr1-associated corepressor-like isoform X2 [Phalaenopsis equestris] Length = 238 Score = 60.8 bits (146), Expect = 2e-06 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVKMYS+FDFL+ VVNKVP LGGTES GDEK Sbjct: 65 LHLKQCVKMYSAFDFLTAVVNKVPTLGGTESFGDEK 100 >ref|XP_020586770.1| dr1-associated corepressor-like isoform X1 [Phalaenopsis equestris] Length = 239 Score = 60.8 bits (146), Expect = 2e-06 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVKMYS+FDFL+ VVNKVP LGGTES GDEK Sbjct: 65 LHLKQCVKMYSAFDFLTAVVNKVPTLGGTESFGDEK 100 >ref|XP_010926426.1| PREDICTED: dr1-associated corepressor homolog isoform X2 [Elaeis guineensis] Length = 241 Score = 59.7 bits (143), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVK YS+FDFL+DVVNKVPNLG TE GDEK Sbjct: 54 LHLKQCVKSYSAFDFLTDVVNKVPNLGSTEPCGDEK 89 >ref|XP_010926425.1| PREDICTED: dr1-associated corepressor homolog isoform X1 [Elaeis guineensis] Length = 252 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 109 LSRKQCVKMYSSFDFLSDVVNKVPNLGGTESGGDEK 2 L KQCVK YS+FDFL+DVVNKVPNLG TE GDEK Sbjct: 65 LHLKQCVKSYSAFDFLTDVVNKVPNLGSTEPCGDEK 100