BLASTX nr result
ID: Ophiopogon25_contig00005578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00005578 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK76685.1| uncharacterized protein A4U43_C03F31030 [Asparagu... 54 4e-06 >gb|ONK76685.1| uncharacterized protein A4U43_C03F31030 [Asparagus officinalis] Length = 150 Score = 53.5 bits (127), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 2/32 (6%) Frame = +1 Query: 1 QTLDWLHGYLLQCIEYGVS--TPKFGNLSKGE 90 QTLDWLHGYLLQCIE+GVS TPK GN SK E Sbjct: 113 QTLDWLHGYLLQCIEHGVSAATPKIGNPSKVE 144