BLASTX nr result
ID: Ophiopogon25_contig00005467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00005467 (618 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK75517.1| uncharacterized protein A4U43_C03F17720 [Asparagu... 69 1e-10 ref|XP_020257383.1| ribosome biogenesis protein TSR3 homolog [As... 69 1e-10 ref|XP_020258707.1| LOW QUALITY PROTEIN: serine/arginine-rich sp... 57 4e-06 ref|XP_008780883.1| PREDICTED: ribosome biogenesis protein TSR3 ... 56 9e-06 ref|XP_008780882.1| PREDICTED: ribosome biogenesis protein TSR3 ... 56 9e-06 >gb|ONK75517.1| uncharacterized protein A4U43_C03F17720 [Asparagus officinalis] Length = 252 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 618 WLASNSRIPKPLPDTEGSDEVPPKANPGSDYDSEDGLPP 502 WL++NSRIPK LPDTEG++E P KA GSDYDSEDGLPP Sbjct: 193 WLSNNSRIPKQLPDTEGTEEAPSKAGLGSDYDSEDGLPP 231 >ref|XP_020257383.1| ribosome biogenesis protein TSR3 homolog [Asparagus officinalis] Length = 274 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 618 WLASNSRIPKPLPDTEGSDEVPPKANPGSDYDSEDGLPP 502 WL++NSRIPK LPDTEG++E P KA GSDYDSEDGLPP Sbjct: 215 WLSNNSRIPKQLPDTEGTEEAPSKAGLGSDYDSEDGLPP 253 >ref|XP_020258707.1| LOW QUALITY PROTEIN: serine/arginine-rich splicing factor 1B-like [Asparagus officinalis] Length = 307 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 617 GLQVTRESPNHFPTQKEVMRCLLKPILDLIMTQKMDFH 504 G Q+T+E PN+F T+KE+ RCL KP+LDLI QK+DFH Sbjct: 265 GFQITQEFPNNFQTRKELRRCLQKPVLDLITIQKIDFH 302 >ref|XP_008780883.1| PREDICTED: ribosome biogenesis protein TSR3 homolog isoform X2 [Phoenix dactylifera] Length = 272 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -1 Query: 618 WLASNSRIPKPLPDTEGSDEVPPKANPGSDYDSEDGLPP 502 WL++NSRIPK P T+G +E N GSDYDSEDGLPP Sbjct: 213 WLSNNSRIPKTPPSTKGHEEDRLDTNEGSDYDSEDGLPP 251 >ref|XP_008780882.1| PREDICTED: ribosome biogenesis protein TSR3 homolog isoform X1 [Phoenix dactylifera] Length = 273 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -1 Query: 618 WLASNSRIPKPLPDTEGSDEVPPKANPGSDYDSEDGLPP 502 WL++NSRIPK P T+G +E N GSDYDSEDGLPP Sbjct: 214 WLSNNSRIPKTPPSTKGHEEDRLDTNEGSDYDSEDGLPP 252