BLASTX nr result
ID: Ophiopogon25_contig00005110
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00005110 (840 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009335365.1| PREDICTED: aspartate--tRNA ligase, chloropla... 86 3e-15 ref|XP_009335364.1| PREDICTED: aspartate--tRNA ligase, chloropla... 86 3e-15 ref|XP_020273207.1| aspartate--tRNA ligase, chloroplastic/mitoch... 86 5e-15 ref|XP_020273203.1| aspartate--tRNA ligase, chloroplastic/mitoch... 86 5e-15 ref|XP_020220489.1| aspartate--tRNA ligase, chloroplastic/mitoch... 80 6e-15 gb|PKI69635.1| hypothetical protein CRG98_009990 [Punica granatum] 80 9e-15 ref|XP_002271358.1| PREDICTED: aspartate--tRNA ligase, chloropla... 83 3e-14 ref|XP_020103068.1| aspartate--tRNA ligase, chloroplastic/mitoch... 83 3e-14 ref|XP_021800079.1| aspartate--tRNA ligase, chloroplastic/mitoch... 82 6e-14 ref|XP_024161521.1| aspartate--tRNA ligase, chloroplastic/mitoch... 82 6e-14 gb|PON86823.1| Aspartate-tRNA ligase, bacterial/mitochondrial-ty... 82 7e-14 ref|XP_019706562.1| PREDICTED: aspartate--tRNA ligase, chloropla... 82 8e-14 ref|XP_010920691.1| PREDICTED: aspartate--tRNA ligase, chloropla... 82 8e-14 ref|XP_018860600.1| PREDICTED: aspartate--tRNA ligase, chloropla... 82 8e-14 ref|XP_010920690.1| PREDICTED: aspartate--tRNA ligase, chloropla... 82 8e-14 ref|XP_009138247.1| PREDICTED: aspartate--tRNA ligase, chloropla... 76 1e-13 ref|XP_003606101.2| aspartyl/asparaginyl-tRNA synthetase family ... 81 1e-13 ref|XP_020528121.1| aspartate--tRNA ligase, chloroplastic/mitoch... 81 2e-13 ref|XP_020528120.1| aspartate--tRNA ligase, chloroplastic/mitoch... 81 2e-13 ref|XP_006852765.1| aspartate--tRNA ligase, chloroplastic/mitoch... 81 2e-13 >ref|XP_009335365.1| PREDICTED: aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X2 [Pyrus x bretschneideri] Length = 645 Score = 86.3 bits (212), Expect = 3e-15 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPTR 695 RLVMLL+GANSIRDVIAFPKTTTAQCALTRTPSPVDPQQL ++S+ T+ Sbjct: 598 RLVMLLAGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLKDLSYQTQ 645 >ref|XP_009335364.1| PREDICTED: aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X1 [Pyrus x bretschneideri] Length = 669 Score = 86.3 bits (212), Expect = 3e-15 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPTR 695 RLVMLL+GANSIRDVIAFPKTTTAQCALTRTPSPVDPQQL ++S+ T+ Sbjct: 622 RLVMLLAGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLKDLSYQTQ 669 >ref|XP_020273207.1| aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X3 [Asparagus officinalis] Length = 626 Score = 85.5 bits (210), Expect = 5e-15 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPTR 695 RLVMLLS A+SIRDVIAFPKTTTAQCALT+ PSPVDPQQLAE+SFP++ Sbjct: 579 RLVMLLSQASSIRDVIAFPKTTTAQCALTKAPSPVDPQQLAELSFPSK 626 >ref|XP_020273203.1| aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X1 [Asparagus officinalis] ref|XP_020273204.1| aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X1 [Asparagus officinalis] ref|XP_020273205.1| aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X1 [Asparagus officinalis] gb|ONK62326.1| uncharacterized protein A4U43_C07F2740 [Asparagus officinalis] Length = 671 Score = 85.5 bits (210), Expect = 5e-15 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPTR 695 RLVMLLS A+SIRDVIAFPKTTTAQCALT+ PSPVDPQQLAE+SFP++ Sbjct: 624 RLVMLLSQASSIRDVIAFPKTTTAQCALTKAPSPVDPQQLAELSFPSK 671 >ref|XP_020220489.1| aspartate--tRNA ligase, chloroplastic/mitochondrial-like, partial [Cajanus cajan] Length = 145 Score = 80.1 bits (196), Expect = 6e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RLVMLL+GANSIRDVIAFPKTTTAQCALTR+PS VDPQQL ++S T Sbjct: 99 RLVMLLAGANSIRDVIAFPKTTTAQCALTRSPSEVDPQQLKDLSIKT 145 >gb|PKI69635.1| hypothetical protein CRG98_009990 [Punica granatum] Length = 147 Score = 79.7 bits (195), Expect = 9e-15 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RLVMLL+GANSIRDVIAFPKTTTAQCALTR PS VDPQQL ++S T Sbjct: 100 RLVMLLAGANSIRDVIAFPKTTTAQCALTRAPSEVDPQQLRDLSLQT 146 >ref|XP_002271358.1| PREDICTED: aspartate--tRNA ligase, chloroplastic/mitochondrial [Vitis vinifera] emb|CBI25118.3| unnamed protein product, partial [Vitis vinifera] Length = 657 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPTR 695 RLVMLL+GANSIRDVIAFPKTTTAQCALTRTPS VDPQQL ++S+ T+ Sbjct: 610 RLVMLLAGANSIRDVIAFPKTTTAQCALTRTPSEVDPQQLKDLSYQTQ 657 >ref|XP_020103068.1| aspartate--tRNA ligase, chloroplastic/mitochondrial [Ananas comosus] ref|XP_020103069.1| aspartate--tRNA ligase, chloroplastic/mitochondrial [Ananas comosus] ref|XP_020103070.1| aspartate--tRNA ligase, chloroplastic/mitochondrial [Ananas comosus] gb|OAY64929.1| Aspartate--tRNA ligase, chloroplastic/mitochondrial [Ananas comosus] Length = 685 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RLVMLL+GANSIRDVIAFPKTTTAQCALT+ PSPVD QL E+SFPT Sbjct: 633 RLVMLLAGANSIRDVIAFPKTTTAQCALTKAPSPVDSHQLKELSFPT 679 >ref|XP_021800079.1| aspartate--tRNA ligase, chloroplastic/mitochondrial-like [Prunus avium] Length = 579 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RL+MLL+GANSIRDVIAFPKTTTAQCALTRTPS VDPQQL ++S+ T Sbjct: 532 RLIMLLAGANSIRDVIAFPKTTTAQCALTRTPSQVDPQQLKDLSYQT 578 >ref|XP_024161521.1| aspartate--tRNA ligase, chloroplastic/mitochondrial [Rosa chinensis] gb|PRQ22216.1| putative aspartate--tRNA ligase [Rosa chinensis] Length = 667 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPTR 695 RLVMLL+GA+SIRDVIAFPKTTTAQCALTR+PS VDPQQL ++SF TR Sbjct: 620 RLVMLLAGASSIRDVIAFPKTTTAQCALTRSPSEVDPQQLKDLSFQTR 667 >gb|PON86823.1| Aspartate-tRNA ligase, bacterial/mitochondrial-type [Trema orientalis] Length = 557 Score = 82.0 bits (201), Expect = 7e-14 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RLVMLL+GANSIRDVIAFPKTTTAQCALTR PS VDPQQL ++SF T Sbjct: 510 RLVMLLAGANSIRDVIAFPKTTTAQCALTRAPSEVDPQQLKDLSFQT 556 >ref|XP_019706562.1| PREDICTED: aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X3 [Elaeis guineensis] Length = 610 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RLVML++GANSIRDVIAFPKTTTAQCALT PS VDPQQL ++SFPT Sbjct: 563 RLVMLVAGANSIRDVIAFPKTTTAQCALTNAPSKVDPQQLKDLSFPT 609 >ref|XP_010920691.1| PREDICTED: aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X2 [Elaeis guineensis] Length = 643 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RLVML++GANSIRDVIAFPKTTTAQCALT PS VDPQQL ++SFPT Sbjct: 596 RLVMLVAGANSIRDVIAFPKTTTAQCALTNAPSKVDPQQLKDLSFPT 642 >ref|XP_018860600.1| PREDICTED: aspartate--tRNA ligase, chloroplastic/mitochondrial [Juglans regia] Length = 660 Score = 82.0 bits (201), Expect = 8e-14 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPTR 695 RLVMLL+GA+SIRDVIAFPKTTTAQCALTR PS VDPQQL ++SF TR Sbjct: 613 RLVMLLAGASSIRDVIAFPKTTTAQCALTRAPSEVDPQQLKDLSFQTR 660 >ref|XP_010920690.1| PREDICTED: aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X1 [Elaeis guineensis] Length = 667 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RLVML++GANSIRDVIAFPKTTTAQCALT PS VDPQQL ++SFPT Sbjct: 620 RLVMLVAGANSIRDVIAFPKTTTAQCALTNAPSKVDPQQLKDLSFPT 666 >ref|XP_009138247.1| PREDICTED: aspartate--tRNA ligase, chloroplastic/mitochondrial-like [Brassica rapa] ref|XP_013666083.1| aspartate--tRNA ligase, chloroplastic/mitochondrial-like [Brassica napus] Length = 122 Score = 76.3 bits (186), Expect = 1e-13 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 R+VM+L+GA+SIRDVIAFPKTTTAQCALTRTPS VDP+QL ++S T Sbjct: 75 RMVMMLAGASSIRDVIAFPKTTTAQCALTRTPSEVDPKQLQDLSIRT 121 >ref|XP_003606101.2| aspartyl/asparaginyl-tRNA synthetase family protein [Medicago truncatula] gb|AES88298.2| aspartyl/asparaginyl-tRNA synthetase family protein [Medicago truncatula] Length = 648 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPTR*F 689 RLVMLL+GANSIRDVIAFPKTTTAQCALTR+PS VDPQQL ++S T+ F Sbjct: 597 RLVMLLAGANSIRDVIAFPKTTTAQCALTRSPSKVDPQQLRDLSITTQTF 646 >ref|XP_020528121.1| aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X3 [Amborella trichopoda] Length = 624 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RLVMLL+GA+SIRDVIAFPKTTTAQCALT+ PS VDPQQL ++SFP+ Sbjct: 578 RLVMLLAGASSIRDVIAFPKTTTAQCALTKAPSEVDPQQLVDLSFPS 624 >ref|XP_020528120.1| aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X2 [Amborella trichopoda] Length = 647 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RLVMLL+GA+SIRDVIAFPKTTTAQCALT+ PS VDPQQL ++SFP+ Sbjct: 601 RLVMLLAGASSIRDVIAFPKTTTAQCALTKAPSEVDPQQLVDLSFPS 647 >ref|XP_006852765.1| aspartate--tRNA ligase, chloroplastic/mitochondrial isoform X1 [Amborella trichopoda] gb|ERN14232.1| hypothetical protein AMTR_s00033p00135980 [Amborella trichopoda] Length = 671 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -3 Query: 838 RLVMLLSGANSIRDVIAFPKTTTAQCALTRTPSPVDPQQLAEISFPT 698 RLVMLL+GA+SIRDVIAFPKTTTAQCALT+ PS VDPQQL ++SFP+ Sbjct: 625 RLVMLLAGASSIRDVIAFPKTTTAQCALTKAPSEVDPQQLVDLSFPS 671