BLASTX nr result
ID: Ophiopogon25_contig00004519
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00004519 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253853.1| peroxiredoxin-2E-1, chloroplastic [Asparagus... 59 3e-08 gb|KCW89258.1| hypothetical protein EUGRSUZ_A01555, partial [Euc... 58 4e-08 gb|AAS21026.1| peroxiredoxin, partial [Hyacinthus orientalis] 57 9e-08 ref|XP_010912227.1| PREDICTED: peroxiredoxin-2E-1, chloroplastic... 59 1e-07 ref|XP_010068989.1| PREDICTED: peroxiredoxin-2E-1, chloroplastic... 58 1e-07 ref|XP_010243544.1| PREDICTED: peroxiredoxin-2E-1, chloroplastic... 58 1e-07 ref|XP_018812389.1| PREDICTED: peroxiredoxin-2E-2, chloroplastic... 58 2e-07 ref|XP_008442791.1| PREDICTED: peroxiredoxin-2E-2, chloroplastic... 57 3e-07 ref|XP_004137869.1| PREDICTED: peroxiredoxin-2E-2, chloroplastic... 57 3e-07 ref|XP_013604352.1| PREDICTED: peroxiredoxin-2E, chloroplastic [... 57 3e-07 ref|XP_015693646.1| PREDICTED: peroxiredoxin-2E-1, chloroplastic... 56 4e-07 gb|KDO61017.1| hypothetical protein CISIN_1g045485mg, partial [C... 56 4e-07 ref|XP_023540807.1| peroxiredoxin-2E-2, chloroplastic-like [Cucu... 57 5e-07 ref|XP_023005841.1| peroxiredoxin-2E-2, chloroplastic-like [Cucu... 57 5e-07 ref|XP_022940624.1| peroxiredoxin-2E-2, chloroplastic-like [Cucu... 57 5e-07 gb|PKI72531.1| hypothetical protein CRG98_007053 [Punica granatum] 57 5e-07 gb|PKA47559.1| Peroxiredoxin-2E-2, chloroplastic [Apostasia shen... 56 7e-07 dbj|GAV61683.1| Redoxin domain-containing protein [Cephalotus fo... 56 7e-07 ref|XP_021621991.1| peroxiredoxin-2E, chloroplastic [Manihot esc... 56 7e-07 ref|XP_009421123.1| PREDICTED: peroxiredoxin-2E-2, chloroplastic... 56 7e-07 >ref|XP_020253853.1| peroxiredoxin-2E-1, chloroplastic [Asparagus officinalis] gb|ONK77626.1| uncharacterized protein A4U43_C02F8770 [Asparagus officinalis] Length = 177 Score = 59.3 bits (142), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFSSAEDMLK+L Sbjct: 147 LLAEDGVVKVLNLEEGGAFTFSSAEDMLKAL 177 >gb|KCW89258.1| hypothetical protein EUGRSUZ_A01555, partial [Eucalyptus grandis] Length = 141 Score = 58.2 bits (139), Expect = 4e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFSSAEDMLK L Sbjct: 111 LLAEDGVVKVLNLEEGGAFTFSSAEDMLKVL 141 >gb|AAS21026.1| peroxiredoxin, partial [Hyacinthus orientalis] Length = 132 Score = 57.0 bits (136), Expect = 9e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKV+NLE+GGAFTFSSA+DMLK+L Sbjct: 102 LLAEDGVVKVVNLEEGGAFTFSSADDMLKAL 132 >ref|XP_010912227.1| PREDICTED: peroxiredoxin-2E-1, chloroplastic [Elaeis guineensis] Length = 229 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 +LAEDGVVKVLNLE+GGAFTFSSAEDMLK+L Sbjct: 199 MLAEDGVVKVLNLEEGGAFTFSSAEDMLKAL 229 >ref|XP_010068989.1| PREDICTED: peroxiredoxin-2E-1, chloroplastic [Eucalyptus grandis] Length = 218 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFSSAEDMLK L Sbjct: 188 LLAEDGVVKVLNLEEGGAFTFSSAEDMLKVL 218 >ref|XP_010243544.1| PREDICTED: peroxiredoxin-2E-1, chloroplastic [Nelumbo nucifera] Length = 227 Score = 58.2 bits (139), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFSSA+DMLK+L Sbjct: 197 LLAEDGVVKVLNLEEGGAFTFSSADDMLKAL 227 >ref|XP_018812389.1| PREDICTED: peroxiredoxin-2E-2, chloroplastic-like [Juglans regia] Length = 228 Score = 57.8 bits (138), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFS AEDMLK+L Sbjct: 198 LLAEDGVVKVLNLEEGGAFTFSGAEDMLKAL 228 >ref|XP_008442791.1| PREDICTED: peroxiredoxin-2E-2, chloroplastic [Cucumis melo] Length = 228 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVK+LNLE+GGAFTFSSAED+LK+L Sbjct: 198 LLAEDGVVKILNLEEGGAFTFSSAEDILKAL 228 >ref|XP_004137869.1| PREDICTED: peroxiredoxin-2E-2, chloroplastic [Cucumis sativus] gb|KGN59051.1| hypothetical protein Csa_3G748800 [Cucumis sativus] Length = 229 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVK+LNLE+GGAFTFSSAED+LK+L Sbjct: 199 LLAEDGVVKILNLEEGGAFTFSSAEDILKAL 229 >ref|XP_013604352.1| PREDICTED: peroxiredoxin-2E, chloroplastic [Brassica oleracea var. oleracea] Length = 230 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 +LAEDGVVKVLNLE+GGAFT+SSAEDMLK+L Sbjct: 200 ILAEDGVVKVLNLEEGGAFTYSSAEDMLKAL 230 >ref|XP_015693646.1| PREDICTED: peroxiredoxin-2E-1, chloroplastic [Oryza brachyantha] Length = 173 Score = 56.2 bits (134), Expect = 4e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFT SSAEDMLK+L Sbjct: 143 LLAEDGVVKVLNLEEGGAFTTSSAEDMLKAL 173 >gb|KDO61017.1| hypothetical protein CISIN_1g045485mg, partial [Citrus sinensis] Length = 164 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAE+GVVKVLNLE+GGAFTFS AEDMLK+L Sbjct: 134 LLAENGVVKVLNLEEGGAFTFSGAEDMLKAL 164 >ref|XP_023540807.1| peroxiredoxin-2E-2, chloroplastic-like [Cucurbita pepo subsp. pepo] Length = 228 Score = 56.6 bits (135), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFSSAED+LK L Sbjct: 198 LLAEDGVVKVLNLEEGGAFTFSSAEDILKVL 228 >ref|XP_023005841.1| peroxiredoxin-2E-2, chloroplastic-like [Cucurbita maxima] Length = 228 Score = 56.6 bits (135), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFSSAED+LK L Sbjct: 198 LLAEDGVVKVLNLEEGGAFTFSSAEDILKVL 228 >ref|XP_022940624.1| peroxiredoxin-2E-2, chloroplastic-like [Cucurbita moschata] Length = 228 Score = 56.6 bits (135), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFSSAED+LK L Sbjct: 198 LLAEDGVVKVLNLEEGGAFTFSSAEDILKVL 228 >gb|PKI72531.1| hypothetical protein CRG98_007053 [Punica granatum] Length = 234 Score = 56.6 bits (135), Expect = 5e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFS AEDMLK L Sbjct: 204 LLAEDGVVKVLNLEEGGAFTFSGAEDMLKVL 234 >gb|PKA47559.1| Peroxiredoxin-2E-2, chloroplastic [Apostasia shenzhenica] Length = 224 Score = 56.2 bits (134), Expect = 7e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFSSAE++LK+L Sbjct: 194 LLAEDGVVKVLNLEEGGAFTFSSAEEILKAL 224 >dbj|GAV61683.1| Redoxin domain-containing protein [Cephalotus follicularis] Length = 228 Score = 56.2 bits (134), Expect = 7e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDGVVKVLNLE+GGAFTFS AED+LK L Sbjct: 198 LLAEDGVVKVLNLEEGGAFTFSGAEDLLKEL 228 >ref|XP_021621991.1| peroxiredoxin-2E, chloroplastic [Manihot esculenta] gb|OAY40920.1| hypothetical protein MANES_09G059900 [Manihot esculenta] Length = 229 Score = 56.2 bits (134), Expect = 7e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 LLAEDG+VKVLNLE+GGAFTFS AEDMLK L Sbjct: 199 LLAEDGIVKVLNLEEGGAFTFSGAEDMLKVL 229 >ref|XP_009421123.1| PREDICTED: peroxiredoxin-2E-2, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 230 Score = 56.2 bits (134), Expect = 7e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -1 Query: 374 LLAEDGVVKVLNLEDGGAFTFSSAEDMLKSL 282 +LA+DGVVKVLNLE+GGAFTFSSA+DMLK+L Sbjct: 200 MLADDGVVKVLNLEEGGAFTFSSADDMLKAL 230