BLASTX nr result
ID: Ophiopogon25_contig00003374
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00003374 (579 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273907.1| LOW QUALITY PROTEIN: anaphase-promoting comp... 59 1e-06 gb|ONK65342.1| uncharacterized protein A4U43_C07F36130 [Asparagu... 59 1e-06 ref|XP_022984323.1| anaphase-promoting complex subunit 6-like [C... 58 2e-06 >ref|XP_020273907.1| LOW QUALITY PROTEIN: anaphase-promoting complex subunit 6 [Asparagus officinalis] Length = 539 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 101 LKEEAVERLRAVARDAPSKHLYSAAIFFSDKVA 3 +KEEAVERLRAV RD+ SKHLYSAAIFFSDKVA Sbjct: 1 MKEEAVERLRAVVRDSLSKHLYSAAIFFSDKVA 33 >gb|ONK65342.1| uncharacterized protein A4U43_C07F36130 [Asparagus officinalis] Length = 539 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 101 LKEEAVERLRAVARDAPSKHLYSAAIFFSDKVA 3 +KEEAVERLRAV RD+ SKHLYSAAIFFSDKVA Sbjct: 1 MKEEAVERLRAVVRDSLSKHLYSAAIFFSDKVA 33 >ref|XP_022984323.1| anaphase-promoting complex subunit 6-like [Cucurbita maxima] Length = 605 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/49 (59%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -2 Query: 146 YIPKNLKN-KKSKQMRLKEEAVERLRAVARDAPSKHLYSAAIFFSDKVA 3 Y NL + + SK MR++EE +E+LR V RD SKHLYS+AIFF+DKVA Sbjct: 39 YCSTNLTSFELSKSMRMREEEIEKLRGVVRDCVSKHLYSSAIFFADKVA 87