BLASTX nr result
ID: Ophiopogon25_contig00003321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00003321 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010906903.1| PREDICTED: protein TIC 62, chloroplastic [El... 57 2e-06 ref|XP_008813258.1| PREDICTED: protein TIC 62, chloroplastic [Ph... 56 4e-06 >ref|XP_010906903.1| PREDICTED: protein TIC 62, chloroplastic [Elaeis guineensis] ref|XP_010906904.1| PREDICTED: protein TIC 62, chloroplastic [Elaeis guineensis] Length = 577 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 456 SVAPQHISQQTSRPLSPYPMYEDLRPPSSPTPSVPKY 346 S QH++QQ + LSP+ MYEDL+PPSSP PSVPKY Sbjct: 541 SAEVQHVNQQKEQALSPFTMYEDLKPPSSPIPSVPKY 577 >ref|XP_008813258.1| PREDICTED: protein TIC 62, chloroplastic [Phoenix dactylifera] Length = 576 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -3 Query: 444 QHISQQTSRPLSPYPMYEDLRPPSSPTPSVPKY 346 QH+ QQ + LSP+ MYEDL+PPSSP PSVPKY Sbjct: 544 QHVKQQKEQALSPFTMYEDLKPPSSPLPSVPKY 576