BLASTX nr result
ID: Ophiopogon25_contig00002403
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00002403 (601 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023522542.1| ATP synthase subunit beta, mitochondrial [Cu... 74 2e-13 ref|XP_022878638.1| ATP synthase subunit beta, mitochondrial-lik... 72 2e-12 emb|CAJ38391.1| mitochondrial ATP synthase, beta chain, partial ... 71 6e-12 ref|XP_023520977.1| ATP synthase subunit beta, mitochondrial [Cu... 74 1e-11 ref|XP_022989976.1| ATP synthase subunit beta, mitochondrial-lik... 74 1e-11 ref|XP_022961437.1| ATP synthase subunit beta, mitochondrial-lik... 74 1e-11 dbj|BAF01799.1| H+-transporting ATP synthase beta chain (mitocho... 71 1e-11 ref|XP_022864527.1| ATP synthase subunit beta, mitochondrial [Ol... 72 1e-11 ref|XP_010044150.1| PREDICTED: ATP synthase subunit beta, mitoch... 73 1e-11 ref|XP_010066667.1| PREDICTED: ATP synthase subunit beta, mitoch... 73 1e-11 gb|PHU01889.1| ATP synthase subunit beta, mitochondrial [Capsicu... 72 2e-11 emb|CDM83903.1| unnamed protein product [Triticum aestivum] 72 2e-11 emb|CAC27141.1| ATP synthase beta chain precursor, partial [Pice... 67 2e-11 dbj|BAJ95263.1| predicted protein [Hordeum vulgare subsp. vulgar... 72 3e-11 ref|XP_020191551.1| ATP synthase subunit beta, mitochondrial [Ae... 72 3e-11 ref|XP_016451334.1| PREDICTED: ATP synthase subunit beta, mitoch... 72 3e-11 ref|XP_016547077.1| PREDICTED: ATP synthase subunit beta, mitoch... 72 3e-11 gb|PHT81626.1| ATP synthase subunit beta, mitochondrial [Capsicu... 72 3e-11 gb|PHT67253.1| ATP synthase subunit beta, mitochondrial [Capsicu... 72 3e-11 ref|XP_022881983.1| ATP synthase subunit beta, mitochondrial-lik... 72 3e-11 >ref|XP_023522542.1| ATP synthase subunit beta, mitochondrial [Cucurbita pepo subsp. pepo] Length = 123 Score = 73.6 bits (179), Expect = 2e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKE VNSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 72 PGKYVELKESVNSFQGVLDGKYDDLSEQSFYMVGG 106 >ref|XP_022878638.1| ATP synthase subunit beta, mitochondrial-like [Olea europaea var. sylvestris] Length = 151 Score = 72.0 bits (175), Expect = 2e-12 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKE +NSFQGVLDGKYDDL+EQSFYMVGG Sbjct: 100 PGKYVELKESINSFQGVLDGKYDDLAEQSFYMVGG 134 >emb|CAJ38391.1| mitochondrial ATP synthase, beta chain, partial [Plantago major] Length = 182 Score = 71.2 bits (173), Expect = 6e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKE +NSFQGVLDGKYDDL EQSFYMVGG Sbjct: 131 PGKYVELKESINSFQGVLDGKYDDLPEQSFYMVGG 165 >ref|XP_023520977.1| ATP synthase subunit beta, mitochondrial [Cucurbita pepo subsp. pepo] Length = 559 Score = 73.6 bits (179), Expect = 1e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKE VNSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 508 PGKYVELKESVNSFQGVLDGKYDDLSEQSFYMVGG 542 >ref|XP_022989976.1| ATP synthase subunit beta, mitochondrial-like [Cucurbita maxima] Length = 559 Score = 73.6 bits (179), Expect = 1e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKE VNSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 508 PGKYVELKESVNSFQGVLDGKYDDLSEQSFYMVGG 542 >ref|XP_022961437.1| ATP synthase subunit beta, mitochondrial-like [Cucurbita moschata] Length = 559 Score = 73.6 bits (179), Expect = 1e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKE VNSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 508 PGKYVELKESVNSFQGVLDGKYDDLSEQSFYMVGG 542 >dbj|BAF01799.1| H+-transporting ATP synthase beta chain (mitochondrial) -like protein, partial [Arabidopsis thaliana] Length = 192 Score = 70.9 bits (172), Expect = 1e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYV+LKE +NSFQG+LDGKYDDLSEQSFYMVGG Sbjct: 141 PGKYVDLKENINSFQGLLDGKYDDLSEQSFYMVGG 175 >ref|XP_022864527.1| ATP synthase subunit beta, mitochondrial [Olea europaea var. sylvestris] Length = 258 Score = 72.0 bits (175), Expect = 1e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKE +NSFQGVLDGKYDDL+EQSFYMVGG Sbjct: 207 PGKYVELKESINSFQGVLDGKYDDLAEQSFYMVGG 241 >ref|XP_010044150.1| PREDICTED: ATP synthase subunit beta, mitochondrial [Eucalyptus grandis] gb|KCW86188.1| hypothetical protein EUGRSUZ_B02878 [Eucalyptus grandis] Length = 556 Score = 73.2 bits (178), Expect = 1e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKE +NSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 505 PGKYVELKESINSFQGVLDGKYDDLSEQSFYMVGG 539 >ref|XP_010066667.1| PREDICTED: ATP synthase subunit beta, mitochondrial [Eucalyptus grandis] gb|KCW64642.1| hypothetical protein EUGRSUZ_G02224 [Eucalyptus grandis] Length = 569 Score = 73.2 bits (178), Expect = 1e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKE +NSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 518 PGKYVELKESINSFQGVLDGKYDDLSEQSFYMVGG 552 >gb|PHU01889.1| ATP synthase subunit beta, mitochondrial [Capsicum chinense] Length = 317 Score = 72.0 bits (175), Expect = 2e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYV+LKE +NSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 266 PGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 300 >emb|CDM83903.1| unnamed protein product [Triticum aestivum] Length = 418 Score = 72.4 bits (176), Expect = 2e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKEGV SFQGVLDGKYDDLSEQ+FYMVGG Sbjct: 368 PGKYVELKEGVQSFQGVLDGKYDDLSEQAFYMVGG 402 >emb|CAC27141.1| ATP synthase beta chain precursor, partial [Picea abies] Length = 76 Score = 67.0 bits (162), Expect = 2e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYV+LKE + SFQGVLDGKYDDL EQSFYMVGG Sbjct: 23 PGKYVDLKESIASFQGVLDGKYDDLPEQSFYMVGG 57 >dbj|BAJ95263.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAJ97326.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 551 Score = 72.4 bits (176), Expect = 3e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKEGV SFQGVLDGKYDDLSEQ+FYMVGG Sbjct: 501 PGKYVELKEGVQSFQGVLDGKYDDLSEQAFYMVGG 535 >ref|XP_020191551.1| ATP synthase subunit beta, mitochondrial [Aegilops tauschii subsp. tauschii] Length = 552 Score = 72.4 bits (176), Expect = 3e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKEGV SFQGVLDGKYDDLSEQ+FYMVGG Sbjct: 502 PGKYVELKEGVQSFQGVLDGKYDDLSEQAFYMVGG 536 >ref|XP_016451334.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Nicotiana tabacum] Length = 376 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYV+LKE +NSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 325 PGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 359 >ref|XP_016547077.1| PREDICTED: ATP synthase subunit beta, mitochondrial [Capsicum annuum] Length = 387 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYV+LKE +NSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 336 PGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 370 >gb|PHT81626.1| ATP synthase subunit beta, mitochondrial [Capsicum annuum] gb|PHU17487.1| ATP synthase subunit beta, mitochondrial [Capsicum chinense] Length = 425 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYV+LKE +NSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 374 PGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 408 >gb|PHT67253.1| ATP synthase subunit beta, mitochondrial [Capsicum annuum] Length = 445 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYV+LKE +NSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 394 PGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 428 >ref|XP_022881983.1| ATP synthase subunit beta, mitochondrial-like [Olea europaea var. sylvestris] Length = 553 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 69 PGKYVELKEGVNSFQGVLDGKYDDLSEQSFYMVGG 173 PGKYVELKE +NSFQGVLDGKYDDL+EQSFYMVGG Sbjct: 502 PGKYVELKESINSFQGVLDGKYDDLAEQSFYMVGG 536