BLASTX nr result
ID: Ophiopogon25_contig00002210
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00002210 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264403.1| calcium/calmodulin-regulated receptor-like k... 57 9e-07 ref|XP_020264402.1| calcium/calmodulin-regulated receptor-like k... 57 9e-07 >ref|XP_020264403.1| calcium/calmodulin-regulated receptor-like kinase 2 isoform X2 [Asparagus officinalis] gb|ONK69391.1| uncharacterized protein A4U43_C05F22370 [Asparagus officinalis] Length = 429 Score = 57.0 bits (136), Expect = 9e-07 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -2 Query: 221 MANQTNXXXXXXXXXXXXXXXXXACAFIVIKFYRKRSHVQHRSNESTVSLPIRVN 57 MANQTN +CAFI I+FYRKRSHVQ+RS ES +LPIRVN Sbjct: 1 MANQTNIIIIGVSVGVAVGILVASCAFIAIRFYRKRSHVQNRSVESASTLPIRVN 55 >ref|XP_020264402.1| calcium/calmodulin-regulated receptor-like kinase 2 isoform X1 [Asparagus officinalis] Length = 431 Score = 57.0 bits (136), Expect = 9e-07 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -2 Query: 221 MANQTNXXXXXXXXXXXXXXXXXACAFIVIKFYRKRSHVQHRSNESTVSLPIRVN 57 MANQTN +CAFI I+FYRKRSHVQ+RS ES +LPIRVN Sbjct: 1 MANQTNIIIIGVSVGVAVGILVASCAFIAIRFYRKRSHVQNRSVESASTLPIRVN 55