BLASTX nr result
ID: Ophiopogon25_contig00002004
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00002004 (1730 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268774.1| E4 SUMO-protein ligase PIAL2-like isoform X2... 62 2e-06 ref|XP_020268773.1| E4 SUMO-protein ligase PIAL2-like isoform X1... 62 2e-06 >ref|XP_020268774.1| E4 SUMO-protein ligase PIAL2-like isoform X2 [Asparagus officinalis] gb|ONK66978.1| uncharacterized protein A4U43_C06F14200 [Asparagus officinalis] Length = 804 Score = 62.4 bits (150), Expect = 2e-06 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -1 Query: 827 TQFQLSSLSTANLYRLKAVVDCLAFIKNSRSNSVRFDSAEFFNLCIARAR 678 T + SSL AN YRLKA+V+ L +I N+RS S+RFDSAEFFNL +A AR Sbjct: 15 TPLKFSSLLEANSYRLKAIVERLTYIMNARSGSIRFDSAEFFNLFVALAR 64 >ref|XP_020268773.1| E4 SUMO-protein ligase PIAL2-like isoform X1 [Asparagus officinalis] Length = 809 Score = 62.4 bits (150), Expect = 2e-06 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -1 Query: 827 TQFQLSSLSTANLYRLKAVVDCLAFIKNSRSNSVRFDSAEFFNLCIARAR 678 T + SSL AN YRLKA+V+ L +I N+RS S+RFDSAEFFNL +A AR Sbjct: 15 TPLKFSSLLEANSYRLKAIVERLTYIMNARSGSIRFDSAEFFNLFVALAR 64