BLASTX nr result
ID: Ophiopogon25_contig00001317
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00001317 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI36563.1| hypothetical protein CRG98_043047 [Punica granatum] 74 3e-14 gb|PLY62480.1| hypothetical protein LSAT_1X71420 [Lactuca sativa] 69 1e-12 gb|KMZ73512.1| putative Epsin-2 [Zostera marina] 75 1e-12 ref|XP_020273004.1| clathrin interactor EPSIN 2 [Asparagus offic... 75 1e-12 ref|XP_006648078.1| PREDICTED: clathrin interactor EPSIN 2 [Oryz... 75 1e-12 ref|XP_016484816.1| PREDICTED: clathrin interactor EPSIN 2-like ... 71 1e-12 ref|XP_009625404.1| PREDICTED: clathrin interactor EPSIN 2-like ... 71 1e-12 ref|XP_008807497.1| PREDICTED: LOW QUALITY PROTEIN: clathrin int... 74 1e-12 ref|XP_010906512.1| PREDICTED: clathrin interactor EPSIN 2 [Elae... 74 1e-12 dbj|GAV90445.1| ENTH domain-containing protein [Cephalotus folli... 74 1e-12 ref|XP_010268291.1| PREDICTED: clathrin interactor EPSIN 2 [Nelu... 74 1e-12 ref|XP_018858974.1| PREDICTED: clathrin interactor EPSIN 2 isofo... 74 1e-12 ref|XP_018858973.1| PREDICTED: clathrin interactor EPSIN 2 isofo... 74 1e-12 gb|OVA11382.1| Epsin domain [Macleaya cordata] 74 1e-12 gb|OWM67669.1| hypothetical protein CDL15_Pgr024754 [Punica gran... 74 2e-12 ref|XP_020113193.1| clathrin interactor EPSIN 2-like isoform X1 ... 74 2e-12 gb|OIW05521.1| hypothetical protein TanjilG_27651 [Lupinus angus... 68 2e-12 gb|OAY76962.1| Clathrin interactor EPSIN 2 [Ananas comosus] 74 2e-12 ref|XP_010524129.1| PREDICTED: clathrin interactor EPSIN 2-like ... 74 3e-12 ref|XP_010524128.1| PREDICTED: clathrin interactor EPSIN 2-like ... 74 3e-12 >gb|PKI36563.1| hypothetical protein CRG98_043047 [Punica granatum] Length = 113 Score = 73.9 bits (180), Expect = 3e-14 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLKVPG+EQK+LDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKVPGVEQKVLDATSNE 37 >gb|PLY62480.1| hypothetical protein LSAT_1X71420 [Lactuca sativa] Length = 55 Score = 68.6 bits (166), Expect = 1e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRD+KR VNKKVLKVP IEQK+LDATSNE Sbjct: 1 MKKAFDQTVRDIKRGVNKKVLKVPSIEQKVLDATSNE 37 >gb|KMZ73512.1| putative Epsin-2 [Zostera marina] Length = 772 Score = 74.7 bits (182), Expect = 1e-12 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 37 >ref|XP_020273004.1| clathrin interactor EPSIN 2 [Asparagus officinalis] Length = 836 Score = 74.7 bits (182), Expect = 1e-12 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 37 >ref|XP_006648078.1| PREDICTED: clathrin interactor EPSIN 2 [Oryza brachyantha] Length = 945 Score = 74.7 bits (182), Expect = 1e-12 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 37 >ref|XP_016484816.1| PREDICTED: clathrin interactor EPSIN 2-like [Nicotiana tabacum] Length = 159 Score = 71.2 bits (173), Expect = 1e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRD+KREVNKKVLKVP IEQK+LDATSNE Sbjct: 1 MKKAFDQTVRDIKREVNKKVLKVPSIEQKVLDATSNE 37 >ref|XP_009625404.1| PREDICTED: clathrin interactor EPSIN 2-like [Nicotiana tomentosiformis] ref|XP_009625405.1| PREDICTED: clathrin interactor EPSIN 2-like [Nicotiana tomentosiformis] Length = 159 Score = 71.2 bits (173), Expect = 1e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRD+KREVNKKVLKVP IEQK+LDATSNE Sbjct: 1 MKKAFDQTVRDIKREVNKKVLKVPSIEQKVLDATSNE 37 >ref|XP_008807497.1| PREDICTED: LOW QUALITY PROTEIN: clathrin interactor EPSIN 2-like [Phoenix dactylifera] Length = 821 Score = 74.3 bits (181), Expect = 1e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLK+PGIEQKILDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKIPGIEQKILDATSNE 37 >ref|XP_010906512.1| PREDICTED: clathrin interactor EPSIN 2 [Elaeis guineensis] Length = 838 Score = 74.3 bits (181), Expect = 1e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLK+PGIEQKILDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKIPGIEQKILDATSNE 37 >dbj|GAV90445.1| ENTH domain-containing protein [Cephalotus follicularis] Length = 884 Score = 74.3 bits (181), Expect = 1e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLKVPGIEQK+LDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKVPGIEQKVLDATSNE 37 >ref|XP_010268291.1| PREDICTED: clathrin interactor EPSIN 2 [Nelumbo nucifera] ref|XP_010268292.1| PREDICTED: clathrin interactor EPSIN 2 [Nelumbo nucifera] ref|XP_010268293.1| PREDICTED: clathrin interactor EPSIN 2 [Nelumbo nucifera] Length = 895 Score = 74.3 bits (181), Expect = 1e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLKVPGIEQK+LDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKVPGIEQKVLDATSNE 37 >ref|XP_018858974.1| PREDICTED: clathrin interactor EPSIN 2 isoform X2 [Juglans regia] Length = 908 Score = 74.3 bits (181), Expect = 1e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLKVPGIEQK+LDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKVPGIEQKVLDATSNE 37 >ref|XP_018858973.1| PREDICTED: clathrin interactor EPSIN 2 isoform X1 [Juglans regia] Length = 914 Score = 74.3 bits (181), Expect = 1e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLKVPGIEQK+LDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKVPGIEQKVLDATSNE 37 >gb|OVA11382.1| Epsin domain [Macleaya cordata] Length = 917 Score = 74.3 bits (181), Expect = 1e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLKVPGIEQK+LDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKVPGIEQKVLDATSNE 37 >gb|OWM67669.1| hypothetical protein CDL15_Pgr024754 [Punica granatum] Length = 802 Score = 73.9 bits (180), Expect = 2e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRDLKREVNKKVLKVPG+EQK+LDATSNE Sbjct: 1 MKKAFDQTVRDLKREVNKKVLKVPGVEQKVLDATSNE 37 >ref|XP_020113193.1| clathrin interactor EPSIN 2-like isoform X1 [Ananas comosus] Length = 860 Score = 73.9 bits (180), Expect = 2e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRD+KREVNKKVLKVPGIEQKILDATSNE Sbjct: 1 MKKAFDQTVRDIKREVNKKVLKVPGIEQKILDATSNE 37 >gb|OIW05521.1| hypothetical protein TanjilG_27651 [Lupinus angustifolius] Length = 56 Score = 67.8 bits (164), Expect = 2e-12 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKK QTVRDLKREVNKKVLKVPGIEQK+LDATSNE Sbjct: 1 MKKVIGQTVRDLKREVNKKVLKVPGIEQKVLDATSNE 37 >gb|OAY76962.1| Clathrin interactor EPSIN 2 [Ananas comosus] Length = 1800 Score = 73.9 bits (180), Expect = 2e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRD+KREVNKKVLKVPGIEQKILDATSNE Sbjct: 1 MKKAFDQTVRDIKREVNKKVLKVPGIEQKILDATSNE 37 >ref|XP_010524129.1| PREDICTED: clathrin interactor EPSIN 2-like isoform X2 [Tarenaya hassleriana] Length = 851 Score = 73.6 bits (179), Expect = 3e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRD+KREVNKKVLKVPGIEQK+LDATSNE Sbjct: 1 MKKAFDQTVRDIKREVNKKVLKVPGIEQKVLDATSNE 37 >ref|XP_010524128.1| PREDICTED: clathrin interactor EPSIN 2-like isoform X1 [Tarenaya hassleriana] Length = 852 Score = 73.6 bits (179), Expect = 3e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 112 MKKAFDQTVRDLKREVNKKVLKVPGIEQKILDATSNE 2 MKKAFDQTVRD+KREVNKKVLKVPGIEQK+LDATSNE Sbjct: 1 MKKAFDQTVRDIKREVNKKVLKVPGIEQKVLDATSNE 37