BLASTX nr result
ID: Ophiopogon24_contig00039380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00039380 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010916048.1| PREDICTED: non-classical arabinogalactan pro... 57 5e-07 >ref|XP_010916048.1| PREDICTED: non-classical arabinogalactan protein 31-like [Elaeis guineensis] Length = 171 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 104 AVEGVVYCASCKLPGYKPAIDASPLRGAIASLVC 3 AVEGV+YC SCKLPGY +IDASPL GA+A L C Sbjct: 42 AVEGVIYCRSCKLPGYDKSIDASPLPGAVAKLQC 75