BLASTX nr result
ID: Ophiopogon24_contig00039103
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00039103 (529 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246321.1| glutaminyl-peptide cyclotransferase [Asparag... 65 2e-09 ref|XP_018683159.1| PREDICTED: glutaminyl-peptide cyclotransfera... 64 7e-09 ref|XP_009405359.1| PREDICTED: glutaminyl-peptide cyclotransfera... 64 1e-08 dbj|BAS95725.1| Os06g0103700, partial [Oryza sativa Japonica Group] 56 8e-07 ref|XP_020685344.1| glutaminyl-peptide cyclotransferase isoform ... 56 3e-06 ref|XP_020685342.1| glutaminyl-peptide cyclotransferase isoform ... 56 4e-06 gb|EEC79824.1| hypothetical protein OsI_21279 [Oryza sativa Indi... 56 4e-06 gb|EAZ35533.1| hypothetical protein OsJ_19815 [Oryza sativa Japo... 56 4e-06 ref|NP_001329255.1| glutaminyl cyclase [Arabidopsis thaliana] >g... 56 4e-06 ref|XP_020685341.1| glutaminyl-peptide cyclotransferase isoform ... 56 4e-06 ref|XP_015643032.1| PREDICTED: glutaminyl-peptide cyclotransfera... 56 4e-06 gb|OAY78811.1| Glutaminyl-peptide cyclotransferase [Ananas comosus] 56 6e-06 ref|XP_003557282.1| PREDICTED: glutaminyl-peptide cyclotransfera... 56 6e-06 ref|XP_020114509.1| LOW QUALITY PROTEIN: glutaminyl-peptide cycl... 56 6e-06 ref|XP_021663580.1| glutaminyl-peptide cyclotransferase-like iso... 55 7e-06 ref|XP_021663579.1| glutaminyl-peptide cyclotransferase-like iso... 55 8e-06 ref|XP_021662528.1| glutaminyl-peptide cyclotransferase-like [He... 55 8e-06 >ref|XP_020246321.1| glutaminyl-peptide cyclotransferase [Asparagus officinalis] gb|ONK80315.1| uncharacterized protein A4U43_C01F16300 [Asparagus officinalis] Length = 322 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 527 KVTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 KV VRYNNHEIP LNELEYVNGEVWANVWQ Sbjct: 209 KVNVRYNNHEIPFLNELEYVNGEVWANVWQ 238 >ref|XP_018683159.1| PREDICTED: glutaminyl-peptide cyclotransferase isoform X2 [Musa acuminata subsp. malaccensis] Length = 249 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 527 KVTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 +VTVRYN+HE+P LNELEYVNGEVWANVWQ Sbjct: 133 RVTVRYNDHEVPYLNELEYVNGEVWANVWQ 162 >ref|XP_009405359.1| PREDICTED: glutaminyl-peptide cyclotransferase isoform X1 [Musa acuminata subsp. malaccensis] Length = 334 Score = 63.5 bits (153), Expect = 1e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 527 KVTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 +VTVRYN+HE+P LNELEYVNGEVWANVWQ Sbjct: 218 RVTVRYNDHEVPYLNELEYVNGEVWANVWQ 247 >dbj|BAS95725.1| Os06g0103700, partial [Oryza sativa Japonica Group] Length = 144 Score = 56.2 bits (134), Expect = 8e-07 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -3 Query: 524 VTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 VTV+Y ++E+P LNELEY+NGEVWANVWQ Sbjct: 29 VTVKYQDNEVPYLNELEYINGEVWANVWQ 57 >ref|XP_020685344.1| glutaminyl-peptide cyclotransferase isoform X4 [Dendrobium catenatum] Length = 244 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 527 KVTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 K TV+YN+HEI LLNELEYVNGEV ANVWQ Sbjct: 124 KTTVKYNDHEISLLNELEYVNGEVLANVWQ 153 >ref|XP_020685342.1| glutaminyl-peptide cyclotransferase isoform X2 [Dendrobium catenatum] Length = 283 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 527 KVTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 K TV+YN+HEI LLNELEYVNGEV ANVWQ Sbjct: 212 KTTVKYNDHEISLLNELEYVNGEVLANVWQ 241 >gb|EEC79824.1| hypothetical protein OsI_21279 [Oryza sativa Indica Group] Length = 323 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -3 Query: 524 VTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 VTV+Y ++E+P LNELEY+NGEVWANVWQ Sbjct: 208 VTVKYQDNEVPYLNELEYINGEVWANVWQ 236 >gb|EAZ35533.1| hypothetical protein OsJ_19815 [Oryza sativa Japonica Group] Length = 323 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -3 Query: 524 VTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 VTV+Y ++E+P LNELEY+NGEVWANVWQ Sbjct: 208 VTVKYQDNEVPYLNELEYINGEVWANVWQ 236 >ref|NP_001329255.1| glutaminyl cyclase [Arabidopsis thaliana] dbj|BAH56793.1| AT4G25720 [Arabidopsis thaliana] gb|ANM67423.1| glutaminyl cyclase [Arabidopsis thaliana] Length = 253 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -3 Query: 527 KVTVRYNNHEIPLLNELEYVNGEVWANVWQVGKLFIEYS 411 K VRYN E+ LNELEY+N EVWANVWQV +LF+ ++ Sbjct: 209 KHIVRYNGREVRYLNELEYINNEVWANVWQVFQLFLIFA 247 >ref|XP_020685341.1| glutaminyl-peptide cyclotransferase isoform X1 [Dendrobium catenatum] gb|PKU75549.1| Glutaminyl-peptide cyclotransferase [Dendrobium catenatum] Length = 332 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 527 KVTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 K TV+YN+HEI LLNELEYVNGEV ANVWQ Sbjct: 212 KTTVKYNDHEISLLNELEYVNGEVLANVWQ 241 >ref|XP_015643032.1| PREDICTED: glutaminyl-peptide cyclotransferase [Oryza sativa Japonica Group] dbj|BAD67954.1| putative glutamine cyclotransferase precursor [Oryza sativa Japonica Group] dbj|BAF18458.1| Os06g0103700 [Oryza sativa Japonica Group] dbj|BAG91795.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAS95724.1| Os06g0103700 [Oryza sativa Japonica Group] Length = 342 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -3 Query: 524 VTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 VTV+Y ++E+P LNELEY+NGEVWANVWQ Sbjct: 227 VTVKYQDNEVPYLNELEYINGEVWANVWQ 255 >gb|OAY78811.1| Glutaminyl-peptide cyclotransferase [Ananas comosus] Length = 334 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 524 VTVRYNNHEIPLLNELEYVNGEVWANVW 441 VTVRY + EIP LNELEYVNGEVWAN+W Sbjct: 222 VTVRYKDREIPFLNELEYVNGEVWANIW 249 >ref|XP_003557282.1| PREDICTED: glutaminyl-peptide cyclotransferase [Brachypodium distachyon] gb|KQK20081.1| hypothetical protein BRADI_1g52340v3 [Brachypodium distachyon] Length = 339 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 524 VTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 VTV+Y + EIP LNELEY+NGEVWANVWQ Sbjct: 224 VTVKYQDSEIPYLNELEYINGEVWANVWQ 252 >ref|XP_020114509.1| LOW QUALITY PROTEIN: glutaminyl-peptide cyclotransferase [Ananas comosus] Length = 399 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 524 VTVRYNNHEIPLLNELEYVNGEVWANVW 441 VTVRY + EIP LNELEYVNGEVWAN+W Sbjct: 287 VTVRYKDREIPFLNELEYVNGEVWANIW 314 >ref|XP_021663580.1| glutaminyl-peptide cyclotransferase-like isoform X2 [Hevea brasiliensis] Length = 284 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 527 KVTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 K TV+Y NHE+ LNELE+VNGEVWANVWQ Sbjct: 207 KHTVKYENHEVRYLNELEFVNGEVWANVWQ 236 >ref|XP_021663579.1| glutaminyl-peptide cyclotransferase-like isoform X1 [Hevea brasiliensis] Length = 319 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 527 KVTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 K TV+Y NHE+ LNELE+VNGEVWANVWQ Sbjct: 207 KHTVKYENHEVRYLNELEFVNGEVWANVWQ 236 >ref|XP_021662528.1| glutaminyl-peptide cyclotransferase-like [Hevea brasiliensis] Length = 319 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 527 KVTVRYNNHEIPLLNELEYVNGEVWANVWQ 438 K TV+Y NHE+ LNELE+VNGEVWANVWQ Sbjct: 207 KHTVKYENHEVRYLNELEFVNGEVWANVWQ 236