BLASTX nr result
ID: Ophiopogon24_contig00038581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00038581 (588 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX57480.1| hypothetical protein RirG_206720 [Rhizophagus irr... 109 9e-28 >gb|EXX57480.1| hypothetical protein RirG_206720 [Rhizophagus irregularis DAOM 197198w] dbj|GBC25947.1| JEMT01027363.1_cds_EXX57480.1_22545 [Rhizophagus irregularis DAOM 181602] gb|PKC66143.1| hypothetical protein RhiirA1_419709 [Rhizophagus irregularis] gb|PKY49106.1| hypothetical protein RhiirA4_239933 [Rhizophagus irregularis] Length = 83 Score = 109 bits (272), Expect = 9e-28 Identities = 58/82 (70%), Positives = 60/82 (73%), Gaps = 4/82 (4%) Frame = +2 Query: 278 MKSLISSIRT---QISINHHISDISTG-STSCLVELGPWERTXXXXXXXXXXXXXFYAAW 445 MKSLISSIRT QISINHHI DIST STSCLVELGPWERT YAAW Sbjct: 1 MKSLISSIRTIRTQISINHHIVDISTSASTSCLVELGPWERTLIHSLIALSLALVVYAAW 60 Query: 446 DPRIEGDLFATKLIEYNYNPVH 511 DPR+EGDL A KLIE+NYNPVH Sbjct: 61 DPRVEGDLLAVKLIEHNYNPVH 82