BLASTX nr result
ID: Ophiopogon24_contig00038509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00038509 (497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK56644.1| hypothetical protein RhiirC2_721737, partial [Rhi... 121 4e-32 gb|PKK73034.1| hypothetical protein RhiirC2_741655, partial [Rhi... 51 8e-06 >gb|PKK56644.1| hypothetical protein RhiirC2_721737, partial [Rhizophagus irregularis] Length = 145 Score = 121 bits (303), Expect = 4e-32 Identities = 69/101 (68%), Positives = 77/101 (76%), Gaps = 6/101 (5%) Frame = -2 Query: 355 SECPSLVEIEALSIGMELVQLESILEPILNLKDSGSLGLKTTFNHKNPFE*LMWN*IRTD 176 SECPSLVEIEALSIGMELVQLESILEPILNLKDSGSLGLKTTFNHKNPFE +++ Sbjct: 17 SECPSLVEIEALSIGMELVQLESILEPILNLKDSGSLGLKTTFNHKNPFEYAEDFSEKSN 76 Query: 175 EL------ISIPTYLCSPFRCGGFQQPDLKSATRSLKNIDF 71 + IS+ + + F+QPDLKSATRSLKNIDF Sbjct: 77 NIYLMFLYISLTNHFLIFWNFPFFRQPDLKSATRSLKNIDF 117 >gb|PKK73034.1| hypothetical protein RhiirC2_741655, partial [Rhizophagus irregularis] Length = 60 Score = 51.2 bits (121), Expect = 8e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -2 Query: 298 QLESILEPILNLKDSGSLGLKTTFNHKNPFE*LMWN*IRTD 176 +LESILEPILNLKDSGSL K TFNHKN E +RTD Sbjct: 25 RLESILEPILNLKDSGSLRFKITFNHKNRSE------LRTD 59