BLASTX nr result
ID: Ophiopogon24_contig00038300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00038300 (629 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74494.1| hypothetical protein M569_00260, partial [Genlise... 56 5e-07 >gb|EPS74494.1| hypothetical protein M569_00260, partial [Genlisea aurea] Length = 76 Score = 55.8 bits (133), Expect = 5e-07 Identities = 35/77 (45%), Positives = 44/77 (57%) Frame = +3 Query: 396 GFSRSIDLNNMLHCWSLRPSRRLGFKVAFILPRREA*CLRF*DENYPLN*VKGRIPTYSL 575 GF+R I+LN+MLH PS L F +A +LPRR + + + R P + Sbjct: 1 GFARCIELNHMLHRLCGPPSIPLSFGLATVLPRRSVSRVSWAPDP--------RRPRANT 52 Query: 576 HRLRCGLRGYLILFAPH 626 HRLR GL GYLILFAPH Sbjct: 53 HRLRHGLPGYLILFAPH 69