BLASTX nr result
ID: Ophiopogon24_contig00038244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00038244 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK68393.1| uncharacterized protein A4U43_C05F11040 [Asparagu... 60 7e-08 ref|XP_020266281.1| pollen receptor-like kinase 4 [Asparagus off... 60 2e-07 >gb|ONK68393.1| uncharacterized protein A4U43_C05F11040 [Asparagus officinalis] Length = 213 Score = 59.7 bits (143), Expect = 7e-08 Identities = 34/70 (48%), Positives = 42/70 (60%) Frame = -2 Query: 211 ASSFQTPMVAETDKMAKVGQGXXXXXXXXXXXXXXXVQGSLVFVSEGRRETFELQDLLRA 32 AS F+ P ++T + + G+ QG LVF++EGRRE F LQDLLRA Sbjct: 17 ASPFRKPRTSDTSCVGR-GRAEGSSKSKATAANGDRGQGDLVFLNEGRRENFGLQDLLRA 75 Query: 31 SAEVLGSGEF 2 SAEVLGSGEF Sbjct: 76 SAEVLGSGEF 85 >ref|XP_020266281.1| pollen receptor-like kinase 4 [Asparagus officinalis] Length = 410 Score = 59.7 bits (143), Expect = 2e-07 Identities = 34/70 (48%), Positives = 42/70 (60%) Frame = -2 Query: 211 ASSFQTPMVAETDKMAKVGQGXXXXXXXXXXXXXXXVQGSLVFVSEGRRETFELQDLLRA 32 AS F+ P ++T + + G+ QG LVF++EGRRE F LQDLLRA Sbjct: 248 ASPFRKPRTSDTSCVGR-GRAEGSSKSKATAANGDRGQGDLVFLNEGRRENFGLQDLLRA 306 Query: 31 SAEVLGSGEF 2 SAEVLGSGEF Sbjct: 307 SAEVLGSGEF 316